KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108531930Help
Entry
108531930         CDS       T04641                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04371  Apelin signaling pathway
rbb05034  Alcoholism
rbb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108531930 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    108531930 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    108531930 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108531930 (HDAC4)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108531930 (HDAC4)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108531930 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 108531930
NCBI-ProteinID: XP_017731056
LinkDB All DBs
Position
Un
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVTREGSAAPLPLYTSPSLPNITLGLPA
TGPAAGTAGQRDAERLALPTLQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQHLVIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQAL
LDEPYLDRLPAQKEAHAPAGVQVKQEPIESDDEEAEPPREVDPGQRQPSEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPVSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKIL
IVDWDVHHGNGTQQAFYSDPSVLYVSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGY
LTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVMEIHSKYWRCLQRATSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDE
EPMEEEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacagtggatgtggccacggcgctgcctcta
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcgctgcct
gtagcagagcccgccctgcgggagcagcagctacagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcagcagcaggagatgctggcc
atgaagcaccagcaggagctgctagaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggaaaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccatcggaatctgaaccactgcatttccagcgacccccgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcaacctcctataaccacccagtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccctctgctacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccattggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctccgggagcgtcagcgcagagaacggcatcgcgcccgccgtc
cccagcatcccggcggagacgagtttggcacacagacttgtgacgcgagaaggctcggcc
gctccacttcccctctacacgtcgccgtccctgcccaacatcacgctgggcctgcctgcc
accggccctgctgctggcacggcgggccagcgggatgccgagagactcgcccttcccacc
ctccagcagcggctctcccttttccctggcacccacctcactccctacctgagcacctcg
cccttggagcgggacggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcgccgctcgtcacagactggtatctttcaggcctgggagca
ctgcccctccacgcacagtccttggttggtgcggaccgggtgtccccttccatccacaag
ctgcggcagcaccgcccgctggggcgaacccagtcggccccgctgccccagaatgcccag
gctctgcagcacctagtcatccagcagcagcatcagcagtttctggagaaacacaagcag
cagttccagcagcagcaactgcacatgaacaagatcatcccgaaaccaagcgagccggcc
cggcagccagagagtcacccagaggagacggaggaggagctccgtgagcaccaggctctg
ctggacgagccctacctggaccggctgccggcgcagaaggaggcgcacgcaccggctggc
gtgcaggtgaagcaggagcccattgagagcgatgacgaagaggcggagcccccgcgggag
gtggacccaggccagcgccagcccagtgagcaggagctgctcttcagacagcaagccctc
ctgctggagcagcagcggatccaccagctgaggaactaccaggcgtccatggaggctgcc
ggcatccccgtgtccttcggcagccacaggcctctgtcccgggcgcagtcctcaccggca
tctgccacctttcccgtgtctgtgcaggagccccccaccaagccaaggttcacgacaggc
ctcgtgtatgacacgctgatgctgaagcaccagtgcacctgcgggagcagcagcagccac
cccgagcacgccgggaggatccagagcatctggtcccgcctgcaggagacaggcctccgg
ggcaaatgcgagtgcatccgcggacgcaaggccaccctggaggagctgcagacggtgcac
tcggaagcccacaccctcctgtacggcacaaaccccctcaaccggcagaaactggacagt
aagaaacttctaggctcgctcgcctccgtgttcgtccgactcccctgcggtggtgttggg
gtggacagcgacaccatctggaacgaggtgcactcagcgggggcggcccgcctggccgtg
ggctgtgtggtggagctggtcttcaaggtggccacgggggagctgaagaatggctttgct
gtggtccgaccccctggacaccacgcggaggagagcacacccatgggcttttgctacttt
aactccgtggccgtggcagccaagcttctgcagcagaggttgagcgtgagcaagatcctc
atcgtggactgggacgtgcaccatggaaacgggacccagcaggctttctacagcgacccc
agcgtcctgtacgtgtccctccaccgctacgatgatgggaacttcttcccgggcagcggg
gctcctgacgaggtgggcacagggcccggcgtgggtttcaatgtcaacatggctttcacc
ggcggcctggaccctcccatgggagacgctgagtacttggcagccttcagaacggtggtc
atgccgatcgccagcgagtttgccccggacgtggtgttggtgtcatcgggcttcgacgcc
gtggagggccaccccacacctctcgggggctacaacctctctgccagatgctttgggtac
ctgacgaagcagctgatgggcctggctggcggccggattgtcctggccctcgagggaggc
cacgacctgaccgccatttgcgacgcctccgaagcatgtgtttctgccttgctgggaaat
gagcttgatcctctcccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgc
tccatggagaaagtcatggaaatccacagcaagtactggcgctgcctgcagcgtgcaacc
tccacggcagggcgttctctgatcgaggctcagacttgcgagaacgaagaagccgagacg
gtcaccgccatggcctcgctgtccgtgggcgtgaagcccgccgaaaagagaccagacgag
gagcccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system