KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532254
Entry
108532254         CDS       T04641                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb04144  Endocytosis
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04625  C-type lectin receptor signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108532254 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108532254 (MDM2)
   04151 PI3K-Akt signaling pathway
    108532254 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108532254 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    108532254 (MDM2)
   04115 p53 signaling pathway
    108532254 (MDM2)
   04218 Cellular senescence
    108532254 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108532254 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108532254 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532254 (MDM2)
   05202 Transcriptional misregulation in cancer
    108532254 (MDM2)
   05206 MicroRNAs in cancer
    108532254 (MDM2)
   05205 Proteoglycans in cancer
    108532254 (MDM2)
   05203 Viral carcinogenesis
    108532254 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    108532254 (MDM2)
   05220 Chronic myeloid leukemia
    108532254 (MDM2)
   05218 Melanoma
    108532254 (MDM2)
   05219 Bladder cancer
    108532254 (MDM2)
   05215 Prostate cancer
    108532254 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108532254 (MDM2)
   05169 Epstein-Barr virus infection
    108532254 (MDM2)
   05165 Human papillomavirus infection
    108532254 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108532254 (MDM2)
   01522 Endocrine resistance
    108532254 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108532254 (MDM2)
   04121 Ubiquitin system [BR:rbb04121]
    108532254 (MDM2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108532254 (MDM2)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    108532254 (MDM2)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    108532254 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 108532254
NCBI-ProteinID: XP_017731689
UniProt: A0A2K6KDN6
LinkDB
Position
Un
AA seq 497 aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEAQELSDEDDEVYRVTVYQAGESDTDSFEED
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgaggagcaggcagatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttctgaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacagaaacttggtagtagtcaatcagcaggaa
tcatcagactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat
caaaaggaccttgtgcaagagcttcaggaagagaaaccttcatcttcacatttggtttct
agaccatctacctcatctagaaggagagcgattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaagcccaagaactctcagatgaagatgatgag
gtatatcgagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat
cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatccccct
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccaaagagtcgtgt
gttgaggaaaatgatgataaaatcacacaagcctcacaatcacaagaaagtgaggactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt
gaaagagaagaaacccaagacaaagaagaaagtgtggaatctagtttgccccttaatgcc
attgaaccttgtgtgatttgtcagggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtgtgtagacaaccaattcagatgattgtgctaacttatttcccctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535938
Entry
108535938         CDS       T04641                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb04144  Endocytosis
rbb04151  PI3K-Akt signaling pathway
rbb04218  Cellular senescence
rbb04625  C-type lectin receptor signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108535938
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108535938
   04151 PI3K-Akt signaling pathway
    108535938
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108535938
  09143 Cell growth and death
   04110 Cell cycle
    108535938
   04115 p53 signaling pathway
    108535938
   04218 Cellular senescence
    108535938
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108535938
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108535938
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535938
   05202 Transcriptional misregulation in cancer
    108535938
   05206 MicroRNAs in cancer
    108535938
   05205 Proteoglycans in cancer
    108535938
   05203 Viral carcinogenesis
    108535938
  09162 Cancer: specific types
   05214 Glioma
    108535938
   05220 Chronic myeloid leukemia
    108535938
   05218 Melanoma
    108535938
   05219 Bladder cancer
    108535938
   05215 Prostate cancer
    108535938
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108535938
   05169 Epstein-Barr virus infection
    108535938
   05165 Human papillomavirus infection
    108535938
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108535938
   01522 Endocrine resistance
    108535938
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108535938
   04121 Ubiquitin system [BR:rbb04121]
    108535938
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108535938
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    108535938
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    108535938
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 108535938
NCBI-ProteinID: XP_017737842
LinkDB
Position
Un
AA seq 452 aa
MVRSRQMCNTNMSIPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEEN
IYHDLQKLGSSQSAGXSSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPST
SSRRRAISEIEENSDELSGEGQRKRHKSDSISLSFDESLLCVNKEICCERSSSSESTGTP
SNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEAQELSDEDDEVYRVT
VYQAGESDTDSFEEDPEISLADYWKCTSCNEMKPPLPSHCNRCWALRENWLPEDKGKDNG
EISEKAKLENSTQAEEGFDVPDCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPST
SSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPXNGCIVHGKTGHLM
ACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggtgaggagcaggcagatgtgcaataccaacatgtctatacctactgatggtgctgta
accacctcacagattccagcttctgaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgtcggtgcacaaaaagacacttatactatgaaagaggaaaat
atataccatgatctacagaaacttggtagtagtcaatcagcaggannatcatcagactca
ggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgatcaaaaggacctt
gtgcaagagcttcaggaagagaaaccttcatcttcacatttggtttctagaccatctacc
tcatctagaaggagagcgattagtgagatagaagaaaattcagatgaattatctggtgaa
ggacaaagaaaacgccacaaatctgatagtatttccctttcctttgatgaaagcttgctc
tgtgtgaataaggagatatgttgtgaaagaagcagtagcagtgaatctacagggacgcca
tcgaatccagatcttgatgctggtgtaagtgaacattcaggtgattggttggatcaggat
tcagtttcagatcagtttagtgtagaatttgaagttgaatctctcgactcagaagattat
agccttagtgaagaagcacaagaactctcagatgaagatgatgaggtatatcgagttact
gtgtatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttcctta
gctgactattggaaatgtacttcatgcaatgaaatgaagccccctcttccatcacattgc
aacagatgttgggcccttcgtgagaattggcttcctgaagataaagggaaagataatggg
gaaatctctgagaaagccaaactggaaaactcaacacaagctgaagagggctttgatgtt
cctgattgtaaaaaaactatagtgaatgattccaaagagtcgtgtgttgaggaaaatgat
gataaaatcacacaagcctcacagtcacaagaaagtgaggactattctcagccatcaact
tctagtagcattatttatagcagccaagaagatgtgaaagagtttgaaagagaagaaaca
caagacaaagaagaaagtgtggaatctagtttgccccttaatgccattgaaccttgtgtg
atttgtcagggtcgacctnaaaatggttgcattgtccatggcaaaacaggacatcttatg
gcctgctttacatgtgcaaagaagctaaagaaaaggaataagccctgcccagtgtgtaga
caaccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system