KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532274
Entry
108532274         CDS       T04641                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03050  Proteasome
rbb04060  Cytokine-cytokine receptor interaction
rbb04066  HIF-1 signaling pathway
rbb04217  Necroptosis
rbb04350  TGF-beta signaling pathway
rbb04380  Osteoclast differentiation
rbb04612  Antigen processing and presentation
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04940  Type I diabetes mellitus
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05164  Influenza A
rbb05168  Herpes simplex virus 1 infection
rbb05200  Pathways in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05332  Graft-versus-host disease
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    108532274 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108532274 (IFNG)
   04630 JAK-STAT signaling pathway
    108532274 (IFNG)
   04066 HIF-1 signaling pathway
    108532274 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108532274 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108532274 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108532274 (IFNG)
   04612 Antigen processing and presentation
    108532274 (IFNG)
   04660 T cell receptor signaling pathway
    108532274 (IFNG)
   04658 Th1 and Th2 cell differentiation
    108532274 (IFNG)
   04659 Th17 cell differentiation
    108532274 (IFNG)
   04657 IL-17 signaling pathway
    108532274 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108532274 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532274 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108532274 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    108532274 (IFNG)
   05323 Rheumatoid arthritis
    108532274 (IFNG)
   05321 Inflammatory bowel disease
    108532274 (IFNG)
   05330 Allograft rejection
    108532274 (IFNG)
   05332 Graft-versus-host disease
    108532274 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108532274 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108532274 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108532274 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108532274 (IFNG)
   05164 Influenza A
    108532274 (IFNG)
   05168 Herpes simplex virus 1 infection
    108532274 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108532274 (IFNG)
   05144 Malaria
    108532274 (IFNG)
   05145 Toxoplasmosis
    108532274 (IFNG)
   05140 Leishmaniasis
    108532274 (IFNG)
   05142 Chagas disease
    108532274 (IFNG)
   05143 African trypanosomiasis
    108532274 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rbb03051]
    108532274 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108532274 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108532274 (IFNG)
Proteasome [BR:rbb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108532274 (IFNG)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interferons
   108532274 (IFNG)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Cytokines
   108532274 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 108532274
NCBI-ProteinID: XP_017731706
LinkDB
Position
Un
AA seq 165 aa
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKXFQXQQKKRDDFEKLTN
YSVTDLNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcattgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtgatccagatgtagcagataatggaactcttttcttagacatcttgaggaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaacttcaaagatgaccagaggatccaaaagagtgtggagaccatcaaggaagacatt
aatgtcaagnnttttcaatagcaacaaaagaaacgggatgacttcgaaaagctgaccaat
tattcggtaactgacttgaatgtccaacgcaaagcagtacatgaactcatccaagtgatg
gctgaactgtcgccagcagctaaaatagggaagcgaaaaaggagtcagatgtttcgaggt
cgaagagcatcccagtaa

DBGET integrated database retrieval system