KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532525
Entry
108532525         CDS       T04641                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00220  Arginine biosynthesis
rbb00330  Arginine and proline metabolism
rbb01100  Metabolic pathways
rbb04020  Calcium signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04370  VEGF signaling pathway
rbb04371  Apelin signaling pathway
rbb04611  Platelet activation
rbb04915  Estrogen signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04931  Insulin resistance
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108532525 (NOS3)
   00330 Arginine and proline metabolism
    108532525 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108532525 (NOS3)
   04371 Apelin signaling pathway
    108532525 (NOS3)
   04066 HIF-1 signaling pathway
    108532525 (NOS3)
   04020 Calcium signaling pathway
    108532525 (NOS3)
   04071 Sphingolipid signaling pathway
    108532525 (NOS3)
   04022 cGMP-PKG signaling pathway
    108532525 (NOS3)
   04151 PI3K-Akt signaling pathway
    108532525 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108532525 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108532525 (NOS3)
   04921 Oxytocin signaling pathway
    108532525 (NOS3)
   04926 Relaxin signaling pathway
    108532525 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108532525 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108532525 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108532525 (NOS3)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108532525 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 108532525
NCBI-ProteinID: XP_017732105
UniProt: A0A2K6MEG7
LinkDB
Position
Un
AA seq 1205 aa
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATSAPEPSRAPASLPPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSIAYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPTP
EQLLSQARDFINQYYSSIKRSGSQAHQQRLQEVEAEVAATGTYQLRENELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKMFQATILSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPSWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEMHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPSSDT
TTNGP
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtggcccaggaacctgggccaccctgtggcctggggctgggg
ctgggccttgggctgtgcggcaagcagggcccagccacctctgcccctgagcccagccgg
gccccggcatccctacccccgccagcgccagaacacagccctccgagctccccgctaacc
cagcccccagaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcgcc
tatgacaccctcagcgcccaggcgcagcaggatgggccctgcaccccaagacgctgcctg
ggctccctggtatttccacggaaactacagggccggccctcccccggccccccgacccct
gagcagctgctgagtcaggcccgggacttcatcaaccagtactacagctccatcaagagg
agcggctctcaggcccaccaacagcggcttcaagaggtggaagccgaggtggcagccaca
ggcacctaccagcttagggagaatgagctggtgttcggggccaagcaggcctggcgcaac
gctccccgctgtgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggac
tgcaggtctgcacaggaaatgttcacctacatctgcaaccacatcaaatacgccaccaac
cggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgaggagac
ttccgaatctggaacagccagctggtgcgctatgcgggctaccggcagcaggatggctct
gtgcggggggacccagccaacgtcgagatcaccgagctctgcattcagcacggctggacc
ccaggaaacggtcgctttgacgtgctgcccctgctgctccaggccccggatgagccccca
gaactcttccttctgccccctgagctggtccttgaggtgccactggagcaccccacgctg
gagtggtttgcagctctgggcctgcgctggtacgccctcccagcagtgtccaacatgctg
ctggaaattgggggcctggagttccccgcagcccccttcagtggctggtacatgagcact
gagatcggcacgaggaacctgtgtgaccctcaccgctacaacatcctggaggacgtggct
gtctgcatggacctggacacccggacaacttcgtccctatggaaagacaaggcagcggtg
gaaatcaacgtggccgtgctgcacagttaccagctggccaaagtcaccattgtggaccac
cacgccgccacagcctccttcatgaagcacctggagaatgagcagaaggccagggggggc
tgccctgcagactgggcctggatcgtgccccccatctcaggcagcctcactcctgtcttc
catcaggagatggtcaactatttcctgtccccagccttccgctaccagccagacccctgg
aaggggagtgcggccaagggcactggcatcaccaggaagaagacctttaaagaagtggcc
aatgccgtgaagatctccgcctcactcatgggcaccgtgatggcgaagcgagtgaaggcg
acaatcctgtacggctccgagaccggccgggcccagagctacgcacagcagctggggaga
cttttccggaaggcttttgatccccgggtcctgtgtatggatgagtacgatgtggtgtcc
cttgaacacgagacgctggtgctggtggtaaccagcacattcgggaatggggatcccccg
gagaatggagagagctttgcagctgccctgatggagatgtctggtccctacaacagctcc
cctcggccagaacagcacaagagttataagatccgcttcaacagcatctcctgctcagac
ccactggtgtcctcttggcggcggaagaggaaggagtccagtaacacagacagtgcaggg
gccctgggcacactcaggttctgtgtgttcgggctgggctcccgggcgtacccccatttc
tgtgcctttgctcgtgcggtggacacgcggctggaggaactgggcggggagcggctgctg
cagctgggccagggtgacgagctgtgtggccaggaggaggccttccgcggctgggcccag
gctgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggctgccgcc
cgagacatcttcagccccaaaaggagttggaagcgccagaggtaccggctgagcacccag
gccgagggcctgcagttgctgccaggcctgatccacgtgcacaggcggaagatgttccag
gctacaattctctcagtggaaaacctacaaagcagcaagtccacgagggccaccatcctg
gtgcgcctggacactggaggccaggaggggctgcagtaccagccgggggaccacataggt
gtctgcccacccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccg
cctgcgcccaccgaacccgtggcagtagagcaactggagaagggcagccctggtggccct
ccccccagctgggtgcgggacccccggctgcccccgtgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccgcccagccctcagctcttgcggctgctcagcaccttg
gcagaagagcccagggaacagcaggagctggaggccctcagtcaggatccccgacgctat
gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccttcg
gtggcactgcctgccccactgctcctcacccagctgcctctgcttcaaccccggtactac
tcagtcagctcagcacccagcacccacccaggagagatgcacctcactgtagctgtgctg
gcatacaggacccaggatgggctgggccccctgcactatggagtctgctccacgtggcta
agccaactcaagcccggagaccctgtgccctgcttcatccggggggctccctccttccgg
ctgccacccgatcccagcttgccctgcatcctggtgggcccaggcactggcattgccccc
ttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccact
cccatgactttggtgtttggctgccgatgctcccaactcgaccatctctaccgcgacgag
gtgcagaacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgggaa
cctgacaaccccaagacctacgtgcaggacatcctgagaacggagctggctgcagaggtg
caccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcaccatggca
accaacgtcctgcagaccgtgcagcgcatcttggcgacggagggcgacatggagctggac
gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacattttc
gggctcacgctgcgcacccaagaggtgacaagccgcatacgcacccagagcttttccttg
caggagcggcagctgcggggcgcagtgccctgggcgttcgacccgcccagctccgacacc
accaccaacggcccctga

DBGET integrated database retrieval system