KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532817
Entry
108532817         CDS       T04641                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01523  Antifolate resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04218  Cellular senescence
rbb04380  Osteoclast differentiation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04668  TNF signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04917  Prolactin signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04926  Relaxin signaling pathway
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05030  Cocaine addiction
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05206  MicroRNAs in cancer
rbb05212  Pancreatic cancer
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05321  Inflammatory bowel disease
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108532817 (NFKB1)
   04014 Ras signaling pathway
    108532817 (NFKB1)
   04064 NF-kappa B signaling pathway
    108532817 (NFKB1)
   04668 TNF signaling pathway
    108532817 (NFKB1)
   04066 HIF-1 signaling pathway
    108532817 (NFKB1)
   04071 Sphingolipid signaling pathway
    108532817 (NFKB1)
   04024 cAMP signaling pathway
    108532817 (NFKB1)
   04151 PI3K-Akt signaling pathway
    108532817 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108532817 (NFKB1)
   04218 Cellular senescence
    108532817 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108532817 (NFKB1)
   04620 Toll-like receptor signaling pathway
    108532817 (NFKB1)
   04621 NOD-like receptor signaling pathway
    108532817 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    108532817 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    108532817 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    108532817 (NFKB1)
   04660 T cell receptor signaling pathway
    108532817 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    108532817 (NFKB1)
   04659 Th17 cell differentiation
    108532817 (NFKB1)
   04657 IL-17 signaling pathway
    108532817 (NFKB1)
   04662 B cell receptor signaling pathway
    108532817 (NFKB1)
   04062 Chemokine signaling pathway
    108532817 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108532817 (NFKB1)
   04917 Prolactin signaling pathway
    108532817 (NFKB1)
   04926 Relaxin signaling pathway
    108532817 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108532817 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108532817 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    108532817 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532817 (NFKB1)
   05202 Transcriptional misregulation in cancer
    108532817 (NFKB1)
   05206 MicroRNAs in cancer
    108532817 (NFKB1)
   05203 Viral carcinogenesis
    108532817 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108532817 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108532817 (NFKB1)
   05221 Acute myeloid leukemia
    108532817 (NFKB1)
   05220 Chronic myeloid leukemia
    108532817 (NFKB1)
   05215 Prostate cancer
    108532817 (NFKB1)
   05222 Small cell lung cancer
    108532817 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108532817 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108532817 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    108532817 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    108532817 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108532817 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108532817 (NFKB1)
   04931 Insulin resistance
    108532817 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108532817 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108532817 (NFKB1)
   05135 Yersinia infection
    108532817 (NFKB1)
   05133 Pertussis
    108532817 (NFKB1)
   05134 Legionellosis
    108532817 (NFKB1)
   05152 Tuberculosis
    108532817 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108532817 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    108532817 (NFKB1)
   05161 Hepatitis B
    108532817 (NFKB1)
   05160 Hepatitis C
    108532817 (NFKB1)
   05171 Coronavirus disease - COVID-19
    108532817 (NFKB1)
   05164 Influenza A
    108532817 (NFKB1)
   05162 Measles
    108532817 (NFKB1)
   05168 Herpes simplex virus 1 infection
    108532817 (NFKB1)
   05163 Human cytomegalovirus infection
    108532817 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108532817 (NFKB1)
   05169 Epstein-Barr virus infection
    108532817 (NFKB1)
   05165 Human papillomavirus infection
    108532817 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108532817 (NFKB1)
   05145 Toxoplasmosis
    108532817 (NFKB1)
   05140 Leishmaniasis
    108532817 (NFKB1)
   05142 Chagas disease
    108532817 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108532817 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108532817 (NFKB1)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108532817 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death YkuD
Other DBs
NCBI-GeneID: 108532817
NCBI-ProteinID: XP_017732574
LinkDB
Position
Un
AA seq 978 aa
MGLATPGFRMAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQP
KQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHA
HSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLL
VHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRR
LEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEEN
GGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYY
PEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYG
FPTYGGITFHPGTTKSNAGMKHGTMDTESKKDSEGCDRSDDRNTVNLFGKVVETTEHNQE
PSEATDGNGEVTLTYATRAKEESARVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLA
VQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAV
ITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGD
GLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDA
HVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVV
PGTTPLDMAASWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDK
NWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQA
ASSPVKTTSQAHSLPLLPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGGSLLT
LNKMPHDYGQEGPLEGKI
NT seq 2937 nt   +upstreamnt  +downstreamnt
atgggattggcgacaccgggcttcagaatggcagaggatgatccatatttgggaaggcct
gaacaaatgtttcatttggatccttctttgactcatacaatatttaatccagaagtattt
caaccacagatggcactgccaacagcagatggcccatatcttcaaatattagagcaacct
aaacagagaggatttcgtttccgttatgtttgtgaaggcccatcccatggtggactacct
ggtgcctctagcgaaaagaacaagaagtcttaccctcaggtcaaaatctgcaactatgtg
ggaccagcaaaggttattgttcagttggtcacaaatggaaaaaatatccacctgcatgcc
cacagcctggtgggaaaacactgtgaggatgggatctgcactgtaactgctggacccaag
gacatggtggtcggcttcgcaaacctgggtatacttcatgtgacaaagaaaaaagtattt
gaaacactggaagcacgaatgacagaggcgtgtataaggggctataatcctggactcttg
gtgcaccctgaccttgcctatttgcaagcagaaggtggaggggaccggcagttgggagat
cgggaaaaagagctaatccgccaagcagctctgcagcaaaccaaggagatggacctcagc
gtggtacggctcatgtttacagcttttcttccggatagcactggcagcttcacaaggcgc
ctggaacccgtggtatcagatgccatctatgacagtaaagcccccaatgcatccaacttg
aaaattgtaagaatggacaggacagctggatgtgtgactggaggggaggaaatttatctt
ctctgtgacaaagttcagaaagatgacatccagattcgattttatgaagaggaggaaaat
ggcggagtctgggaaggatttggagatttttcccccacagatgttcatagacaatttgcc
atcgtcttcaaaactccaaagtataaagatgttaatattacgaaaccagcctctgtgttc
gtacagcttcggaggaaatctgacttggaaactagtgaaccaaaacctttcctctactat
cctgaaatcaaagataaagaagaagtacagaggaaacggcagaagctcatgcccaatttt
tcggatagtttcggcggtgggagtggcgctggagctggaggcggaggcatgtttggtagt
ggcggtggaggagggggcactggaagtacagggccagggtatagcttcccgcactatgga
tttcctacttatggtgggattaccttccatcctggaactactaaatctaatgctgggatg
aagcatggaaccatggacactgaatctaaaaaggactctgaaggttgtgacagaagtgat
gacagaaacactgtaaacctctttgggaaagtcgttgaaaccacagagcacaatcaggag
cccagcgaggccactgatgggaatggtgaggtcactctaacgtatgcaacaagagcaaaa
gaagagagtgctagggttcaggataacctctttctagagaaggctatgcagcttgcaaag
aggcatgccaatgcccttttcgactacgccgtgacaggagacgtgaagatgctgctggcc
gtccagcgccatctcactgccgtgcaggatgagaatggggacagtgtcttacacttagca
atcatccaccttcattctcaacttgtgagggatctactagaagtcacatctggtttgatt
tctgatgacattatcaacatgagaaatgacctgtaccagacgcccttgcacttggcagtg
atcactaagcaggaagatgtggtggaggatttgctgagggctggggccgacctgagcctt
ctggaccgcttgggtaactctgttttgcacctagctgccaaagaaggacatgataaagtt
ctcagtatcttactcaagcacaaaaaggcagcactacttcttgaccaccccaatggggac
ggtctgaatgccattcatctagccatgatgagcaatagcctgccatgtttgctgctgctg
gtggccgctggggccgacgtcaatgctcaggagcaaaagtccgggcgcacagcactgcac
ctggctgtggagcacgacaacatctcattggcaggctgcctgctcctggagggtgacgcc
catgtggacagtactacctacgatggaaccacacccctgcatatagcagctgggagaggg
tccaccaggctggcagctcttctcaaagcagcaggagcagatcccctggtggagaacttt
gagcctctctatgacctggatgactcttgggaaaatgcaggagaggatgaaggagttgtg
cctggaaccacgcctctagatatggccgccagctggcaggtatttgacatattaaatggg
aaaccatatgagccagagtttacatctgatgatttactagcacaaggagacatgaaacag
ctggctgaagatgtgaagctgcagctctataagttgctagaaattcctgatccagacaaa
aactgggctactctggcacagaaattaggcctggggatacttaataatgccttccggctg
agtcctgctccttccaaaacacttatggacaactatgaggtctctggagggacagtcaga
gagctggtggaggctctgagacaaatgggctacactgaagcgattgaagtgatccaggca
gcctccagcccagtgaagaccacctctcaggcccactcgctgcctctcttgcctgcctcc
acaaggcagcaaatagatgagctccgagacagcgacagtgtctgcgacagcggcgtggag
acgtccttccgcaaactcagctttactgagtctctgaccagtggtggctcactgctaact
ctcaacaaaatgccccatgattatgggcaggaaggacctctagaaggcaaaatttag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543519
Entry
108543519         CDS       T04641                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01523  Antifolate resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04137  Mitophagy - animal
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04218  Cellular senescence
rbb04380  Osteoclast differentiation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04668  TNF signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04917  Prolactin signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04926  Relaxin signaling pathway
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05030  Cocaine addiction
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05212  Pancreatic cancer
rbb05215  Prostate cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05321  Inflammatory bowel disease
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108543519 (RELA)
   04014 Ras signaling pathway
    108543519 (RELA)
   04064 NF-kappa B signaling pathway
    108543519 (RELA)
   04668 TNF signaling pathway
    108543519 (RELA)
   04066 HIF-1 signaling pathway
    108543519 (RELA)
   04071 Sphingolipid signaling pathway
    108543519 (RELA)
   04024 cAMP signaling pathway
    108543519 (RELA)
   04151 PI3K-Akt signaling pathway
    108543519 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108543519 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    108543519 (RELA)
   04218 Cellular senescence
    108543519 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108543519 (RELA)
   04620 Toll-like receptor signaling pathway
    108543519 (RELA)
   04621 NOD-like receptor signaling pathway
    108543519 (RELA)
   04622 RIG-I-like receptor signaling pathway
    108543519 (RELA)
   04623 Cytosolic DNA-sensing pathway
    108543519 (RELA)
   04625 C-type lectin receptor signaling pathway
    108543519 (RELA)
   04660 T cell receptor signaling pathway
    108543519 (RELA)
   04658 Th1 and Th2 cell differentiation
    108543519 (RELA)
   04659 Th17 cell differentiation
    108543519 (RELA)
   04657 IL-17 signaling pathway
    108543519 (RELA)
   04662 B cell receptor signaling pathway
    108543519 (RELA)
   04062 Chemokine signaling pathway
    108543519 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108543519 (RELA)
   04917 Prolactin signaling pathway
    108543519 (RELA)
   04926 Relaxin signaling pathway
    108543519 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108543519 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108543519 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    108543519 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108543519 (RELA)
   05202 Transcriptional misregulation in cancer
    108543519 (RELA)
   05203 Viral carcinogenesis
    108543519 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108543519 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108543519 (RELA)
   05221 Acute myeloid leukemia
    108543519 (RELA)
   05220 Chronic myeloid leukemia
    108543519 (RELA)
   05215 Prostate cancer
    108543519 (RELA)
   05222 Small cell lung cancer
    108543519 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108543519 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108543519 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    108543519 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    108543519 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108543519 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108543519 (RELA)
   04931 Insulin resistance
    108543519 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108543519 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108543519 (RELA)
   05135 Yersinia infection
    108543519 (RELA)
   05133 Pertussis
    108543519 (RELA)
   05134 Legionellosis
    108543519 (RELA)
   05152 Tuberculosis
    108543519 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108543519 (RELA)
   05170 Human immunodeficiency virus 1 infection
    108543519 (RELA)
   05161 Hepatitis B
    108543519 (RELA)
   05160 Hepatitis C
    108543519 (RELA)
   05171 Coronavirus disease - COVID-19
    108543519 (RELA)
   05164 Influenza A
    108543519 (RELA)
   05162 Measles
    108543519 (RELA)
   05168 Herpes simplex virus 1 infection
    108543519 (RELA)
   05163 Human cytomegalovirus infection
    108543519 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108543519 (RELA)
   05169 Epstein-Barr virus infection
    108543519 (RELA)
   05165 Human papillomavirus infection
    108543519 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108543519 (RELA)
   05145 Toxoplasmosis
    108543519 (RELA)
   05140 Leishmaniasis
    108543519 (RELA)
   05142 Chagas disease
    108543519 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108543519 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108543519 (RELA)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108543519 (RELA)
SSDB
Motif
Pfam: RHD_dimer
Other DBs
NCBI-GeneID: 108543519
NCBI-ProteinID: XP_017749489
UniProt: A0A2K6L3K9
LinkDB
Position
Un
AA seq 282 aa
MQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPR
RIAVPSRSSASVPKPAPQPYPFTSPLSTINYDEFPTMVFPSGQIRQASALASAPPQVLPQ
APAPAPAPAMVSALAQAPAPVPVLAPGPPQAMVPPAPKPTQAGEGTLSEALLQLQFDDED
LGALLGNSTDPTVFTDLASVDNSEFQQLLNQGVPVAPHTTEPMLMEYPEAITRLVTGAQR
PPDPAPAPLGAPGLPNGLLSGDEDFSSIVDMDFSALLSQISS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgcagctgcggcggccttccgaccgggagcttagtgagcccatggaattccagtacctg
ccagatacagacgatcgtcaccggattgaggagaaacgcaaaaggacatatgagaccttc
aagagcatcatgaagaagagtcctttcagcggacccactgacccccggcctccacctcgg
cgcattgctgtgccttcccgcagctcagcttctgttcccaagccagcaccccagccctat
ccctttacgtcacccctgagcaccatcaactatgatgagtttcccaccatggtgtttcct
tctgggcagataaggcaggcctcagccttggcctcggcccctccccaagtactgccccag
gctccagcccctgcccctgctccagccatggtatcagctctggcccaggccccagcccct
gtcccagtcctagccccaggccctcctcaggctatggtcccacctgcccccaagcccacc
caggctggggaaggaacgctgtcagaggccctgctgcagctgcagtttgatgatgaagac
ctgggggccttgcttggcaacagcacagacccaaccgtgttcacagacctggcatcagtc
gacaactccgagtttcagcagctgctgaaccagggcgtacctgtagccccccacacaact
gagcccatgttgatggagtaccctgaggctataactcgcctagtgacaggggcccagagg
ccccctgacccagctcctgctccactgggagccccggggctccccaacggcctcctttca
ggagatgaagacttctcctccattgtggacatggacttctcagccctgctgagtcagatc
agctcctaa

DBGET integrated database retrieval system