KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532869Help
Entry
108532869         CDS       T04641                                 

Gene name
GNG12
Definition
(RefSeq) G protein subunit gamma 12
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04062  Chemokine signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04371  Apelin signaling pathway
rbb04713  Circadian entrainment
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04810  Regulation of actin cytoskeleton
rbb04926  Relaxin signaling pathway
rbb05032  Morphine addiction
rbb05034  Alcoholism
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108532869 (GNG12)
   04010 MAPK signaling pathway
    108532869 (GNG12)
   04371 Apelin signaling pathway
    108532869 (GNG12)
   04151 PI3K-Akt signaling pathway
    108532869 (GNG12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108532869 (GNG12)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    108532869 (GNG12)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108532869 (GNG12)
  09156 Nervous system
   04724 Glutamatergic synapse
    108532869 (GNG12)
   04727 GABAergic synapse
    108532869 (GNG12)
   04725 Cholinergic synapse
    108532869 (GNG12)
   04728 Dopaminergic synapse
    108532869 (GNG12)
   04726 Serotonergic synapse
    108532869 (GNG12)
   04723 Retrograde endocannabinoid signaling
    108532869 (GNG12)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108532869 (GNG12)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    108532869 (GNG12)
  09165 Substance dependence
   05032 Morphine addiction
    108532869 (GNG12)
   05034 Alcoholism
    108532869 (GNG12)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    108532869 (GNG12)
   05163 Human cytomegalovirus infection
    108532869 (GNG12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108532869 (GNG12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108532869 (GNG12)
   04031 GTP-binding proteins [BR:rbb04031]
    108532869 (GNG12)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108532869 (GNG12)
  Exosomal proteins of colorectal cancer cells
   108532869 (GNG12)
GTP-binding proteins [BR:rbb04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    108532869 (GNG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 108532869
NCBI-ProteinID: XP_017732635
UniProt: A0A2K6M4U8
LinkDB All DBs
Position
Un
AA seq 72 aa AA seqDB search
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaacagcaagtaccaacaatatagcccaggcaaggagaactgtgcagcag
ttaagattagaagcctccattgaaagaataaaggtttcgaaggcatcagcggacctcatg
tcctactgtgaggaacatgccaggagtgaccctttgctgataggaataccaacttcagaa
aaccctttcaaggataaaaaaacttgcatcatcttatag

DBGET integrated database retrieval system