KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532960
Entry
108532960         CDS       T04641                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04926  Relaxin signaling pathway
rbb04929  GnRH secretion
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05100  Bacterial invasion of epithelial cells
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05146  Amoebiasis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108532960 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108532960 (PIK3CA)
   04014 Ras signaling pathway
    108532960 (PIK3CA)
   04015 Rap1 signaling pathway
    108532960 (PIK3CA)
   04370 VEGF signaling pathway
    108532960 (PIK3CA)
   04630 JAK-STAT signaling pathway
    108532960 (PIK3CA)
   04668 TNF signaling pathway
    108532960 (PIK3CA)
   04066 HIF-1 signaling pathway
    108532960 (PIK3CA)
   04068 FoxO signaling pathway
    108532960 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    108532960 (PIK3CA)
   04072 Phospholipase D signaling pathway
    108532960 (PIK3CA)
   04071 Sphingolipid signaling pathway
    108532960 (PIK3CA)
   04024 cAMP signaling pathway
    108532960 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    108532960 (PIK3CA)
   04152 AMPK signaling pathway
    108532960 (PIK3CA)
   04150 mTOR signaling pathway
    108532960 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108532960 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    108532960 (PIK3CA)
   04218 Cellular senescence
    108532960 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108532960 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    108532960 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108532960 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108532960 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    108532960 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    108532960 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    108532960 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    108532960 (PIK3CA)
   04660 T cell receptor signaling pathway
    108532960 (PIK3CA)
   04662 B cell receptor signaling pathway
    108532960 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    108532960 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    108532960 (PIK3CA)
   04670 Leukocyte transendothelial migration
    108532960 (PIK3CA)
   04062 Chemokine signaling pathway
    108532960 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108532960 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    108532960 (PIK3CA)
   04929 GnRH secretion
    108532960 (PIK3CA)
   04915 Estrogen signaling pathway
    108532960 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    108532960 (PIK3CA)
   04917 Prolactin signaling pathway
    108532960 (PIK3CA)
   04926 Relaxin signaling pathway
    108532960 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    108532960 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    108532960 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108532960 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108532960 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    108532960 (PIK3CA)
   04722 Neurotrophin signaling pathway
    108532960 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108532960 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    108532960 (PIK3CA)
   04380 Osteoclast differentiation
    108532960 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    108532960 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    108532960 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532960 (PIK3CA)
   05206 MicroRNAs in cancer
    108532960 (PIK3CA)
   05205 Proteoglycans in cancer
    108532960 (PIK3CA)
   05203 Viral carcinogenesis
    108532960 (PIK3CA)
   05230 Central carbon metabolism in cancer
    108532960 (PIK3CA)
   05231 Choline metabolism in cancer
    108532960 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108532960 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108532960 (PIK3CA)
   05212 Pancreatic cancer
    108532960 (PIK3CA)
   05225 Hepatocellular carcinoma
    108532960 (PIK3CA)
   05226 Gastric cancer
    108532960 (PIK3CA)
   05214 Glioma
    108532960 (PIK3CA)
   05221 Acute myeloid leukemia
    108532960 (PIK3CA)
   05220 Chronic myeloid leukemia
    108532960 (PIK3CA)
   05218 Melanoma
    108532960 (PIK3CA)
   05211 Renal cell carcinoma
    108532960 (PIK3CA)
   05215 Prostate cancer
    108532960 (PIK3CA)
   05213 Endometrial cancer
    108532960 (PIK3CA)
   05224 Breast cancer
    108532960 (PIK3CA)
   05222 Small cell lung cancer
    108532960 (PIK3CA)
   05223 Non-small cell lung cancer
    108532960 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108532960 (PIK3CA)
   05017 Spinocerebellar ataxia
    108532960 (PIK3CA)
   05020 Prion disease
    108532960 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108532960 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108532960 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    108532960 (PIK3CA)
   04931 Insulin resistance
    108532960 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108532960 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108532960 (PIK3CA)
   05135 Yersinia infection
    108532960 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    108532960 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108532960 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    108532960 (PIK3CA)
   05161 Hepatitis B
    108532960 (PIK3CA)
   05160 Hepatitis C
    108532960 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    108532960 (PIK3CA)
   05164 Influenza A
    108532960 (PIK3CA)
   05162 Measles
    108532960 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    108532960 (PIK3CA)
   05163 Human cytomegalovirus infection
    108532960 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108532960 (PIK3CA)
   05169 Epstein-Barr virus infection
    108532960 (PIK3CA)
   05165 Human papillomavirus infection
    108532960 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108532960 (PIK3CA)
   05142 Chagas disease
    108532960 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108532960 (PIK3CA)
   01524 Platinum drug resistance
    108532960 (PIK3CA)
   01522 Endocrine resistance
    108532960 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108532960 (PIK3CA)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     108532960 (PIK3CA)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    108532960 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC
Other DBs
NCBI-GeneID: 108532960
NCBI-ProteinID: XP_017732771
LinkDB
Position
Un
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVSQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEXKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcgccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagta
attgccgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacagctaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatatacattcctgaccttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaattggtctgtg
tcccgagaagcaggatttagctattcccacgcaggactgagtaacagactagctagagac
aatgaattaagggaaaatgacaaagaacagctcaaagcaatttctacacgagatcctctc
tctgaaatcactgagcaggagaaagattttctatggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
tcccagatgtattgcttggtaaaagactggcctccaatcaaacctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttactgaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggtttggcctgcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctgaataggcaagtcgaggcaatggaaaagctcattaacttaactgacattctcaaa
caggagnaaaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctacagggctttctatctcctctaaaccctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacactctacatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgtttacacgttca
tgtgctggatattgtgtcgctaccttcattctgggaattggagatcgtcacaatagtaac
atcatggtgaaagacgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgcattgaactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534276
Entry
108534276         CDS       T04641                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04926  Relaxin signaling pathway
rbb04929  GnRH secretion
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05100  Bacterial invasion of epithelial cells
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05146  Amoebiasis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108534276 (PIK3R2)
   04014 Ras signaling pathway
    108534276 (PIK3R2)
   04015 Rap1 signaling pathway
    108534276 (PIK3R2)
   04370 VEGF signaling pathway
    108534276 (PIK3R2)
   04630 JAK-STAT signaling pathway
    108534276 (PIK3R2)
   04668 TNF signaling pathway
    108534276 (PIK3R2)
   04066 HIF-1 signaling pathway
    108534276 (PIK3R2)
   04068 FoxO signaling pathway
    108534276 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    108534276 (PIK3R2)
   04072 Phospholipase D signaling pathway
    108534276 (PIK3R2)
   04071 Sphingolipid signaling pathway
    108534276 (PIK3R2)
   04024 cAMP signaling pathway
    108534276 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    108534276 (PIK3R2)
   04152 AMPK signaling pathway
    108534276 (PIK3R2)
   04150 mTOR signaling pathway
    108534276 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108534276 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    108534276 (PIK3R2)
   04218 Cellular senescence
    108534276 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108534276 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    108534276 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108534276 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108534276 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    108534276 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    108534276 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    108534276 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    108534276 (PIK3R2)
   04660 T cell receptor signaling pathway
    108534276 (PIK3R2)
   04662 B cell receptor signaling pathway
    108534276 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    108534276 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    108534276 (PIK3R2)
   04670 Leukocyte transendothelial migration
    108534276 (PIK3R2)
   04062 Chemokine signaling pathway
    108534276 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108534276 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    108534276 (PIK3R2)
   04929 GnRH secretion
    108534276 (PIK3R2)
   04915 Estrogen signaling pathway
    108534276 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    108534276 (PIK3R2)
   04917 Prolactin signaling pathway
    108534276 (PIK3R2)
   04926 Relaxin signaling pathway
    108534276 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    108534276 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    108534276 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108534276 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108534276 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    108534276 (PIK3R2)
   04722 Neurotrophin signaling pathway
    108534276 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108534276 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    108534276 (PIK3R2)
   04380 Osteoclast differentiation
    108534276 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    108534276 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    108534276 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108534276 (PIK3R2)
   05206 MicroRNAs in cancer
    108534276 (PIK3R2)
   05205 Proteoglycans in cancer
    108534276 (PIK3R2)
   05203 Viral carcinogenesis
    108534276 (PIK3R2)
   05230 Central carbon metabolism in cancer
    108534276 (PIK3R2)
   05231 Choline metabolism in cancer
    108534276 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108534276 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108534276 (PIK3R2)
   05212 Pancreatic cancer
    108534276 (PIK3R2)
   05225 Hepatocellular carcinoma
    108534276 (PIK3R2)
   05226 Gastric cancer
    108534276 (PIK3R2)
   05214 Glioma
    108534276 (PIK3R2)
   05221 Acute myeloid leukemia
    108534276 (PIK3R2)
   05220 Chronic myeloid leukemia
    108534276 (PIK3R2)
   05218 Melanoma
    108534276 (PIK3R2)
   05211 Renal cell carcinoma
    108534276 (PIK3R2)
   05215 Prostate cancer
    108534276 (PIK3R2)
   05213 Endometrial cancer
    108534276 (PIK3R2)
   05224 Breast cancer
    108534276 (PIK3R2)
   05222 Small cell lung cancer
    108534276 (PIK3R2)
   05223 Non-small cell lung cancer
    108534276 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108534276 (PIK3R2)
   05017 Spinocerebellar ataxia
    108534276 (PIK3R2)
   05020 Prion disease
    108534276 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108534276 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108534276 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    108534276 (PIK3R2)
   04931 Insulin resistance
    108534276 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108534276 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108534276 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    108534276 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108534276 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    108534276 (PIK3R2)
   05161 Hepatitis B
    108534276 (PIK3R2)
   05160 Hepatitis C
    108534276 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    108534276 (PIK3R2)
   05164 Influenza A
    108534276 (PIK3R2)
   05162 Measles
    108534276 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    108534276 (PIK3R2)
   05163 Human cytomegalovirus infection
    108534276 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108534276 (PIK3R2)
   05169 Epstein-Barr virus infection
    108534276 (PIK3R2)
   05165 Human papillomavirus infection
    108534276 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108534276 (PIK3R2)
   05142 Chagas disease
    108534276 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108534276 (PIK3R2)
   01524 Platinum drug resistance
    108534276 (PIK3R2)
   01522 Endocrine resistance
    108534276 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108534276 (PIK3R2)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    108534276 (PIK3R2)
SSDB
Motif
Pfam: SH2 PI3K_P85_iSH2 SH3_1 SH3_9 ATG11 Ribosomal_L22e V_ATPase_I
Other DBs
NCBI-GeneID: 108534276
NCBI-ProteinID: XP_017735050
LinkDB
Position
Un
AA seq 571 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGEQQSGALEKGGG
PLRPLVSSSVQSSPPPGGAPDGSEPSSDFPALLVEKLLQEHLEEQEVAPPALPPKPPKAK
LAPAGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLR
KGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRLLYPVSKYQQ
DQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQVLQAPHMRKIKASAPPHP
SHRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQY
LVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLS
GKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQ
HASLVQHNDALTVTLAHPVRAPGPGPPPAAR
NT seq 1716 nt   +upstreamnt  +downstreamnt
atggcgggccctgagggtttccagtaccgtgctctgtacccgttccgccgggagcggcca
gaggacctggagctgctgcctggcgacgtgctggtagtgagccgggcggccttgcaggca
ctgggtgtggccgagggtggcgagcgctgcccacagagcgtgggctggatgcccggcctc
aacgagcgcacacggcagcgaggtgactttcctggcacctatgtcgagttcctggggccc
gtggccctggcccggcccggccctcgcccacggggcccccgcccactgcccgccaggccc
cgtgatggggcccctgagccaggtgagcagcaatcaggggcactggagaaggggggtggt
cccctcagacccttggtctcctcttctgtccagtcctcgccgccgccagggggcgctccc
gacgggagtgagcccagttctgacttcccggcgctgctggtggagaagctgcttcaggag
cacttggaagagcaggaggttgcacccccagcgctgccgcctaaaccccccaaggcaaag
ctggcccctgcaggcctggcgaatggagggagcccaccctccctgcaggatgccgagtgg
tactggggagacatttcaagggaggaggtgaatgagaaactccgggacactcccgatggc
accttcctagtccgagatgcttccagcaagatccagggcgagtacacgctgaccctcagg
aaaggcgggaacaataaactgatcaaggtcttccaccgagatgggcactacggcttctca
gagccactcaccttctgctccgtcgtggacctcatcaatcactaccgccacgagtcgctg
gcccagtacaacgccaagctggacacacggctcctctaccctgtgtccaaataccagcag
gaccagattgtcaaggaggacagtgtggaggcggtgggcgcccagctcaaggtctatcac
cagcagtaccaggacaagagccgcgagtatgaccagctctatgaagagtacacacggacc
tcccaggtactccaggccccgcacatgaggaaaatcaaggcctctgcgccaccccacccc
tcccacaggatcctgcttaactctgagaggctcaagtcccgcattgccgagatccacgag
agccgcacgaagctggagcagcagctgcgggcccaggcctcggacaaccgggagatcgac
aagcgcatgaacagcctcaagccagacctcatgcagctgcgtaagatccgagaccagtac
cttgtgtggctcacccagaaaggcgcccggcagaagaaaatcaacgagtggctggggatc
aaaaatgagactgaggaccagtacgcgctgatggaggacgaggacgatctcccgcaccac
gaggaacgcacttggtacgtgggcaagatcaaccgcacgcaggcagaggagatgctgagt
ggcaagcgggatggcaccttcctcatccgcgagagcagccagcggggctgctacgcctgc
tccgtggtggtggacggagacaccaagcactgcgtcatctaccgcacggccaccggcttc
ggcttcgcggagccctacaacctgtatgggtcgctgaaggagctggtgctgcactaccag
cacgcctcgctcgtgcagcacaacgacgcgctcaccgtcaccctggcgcacccagtacgc
gccccgggccccggcccgccgcctgccgcccgctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535636
Entry
108535636         CDS       T04641                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04926  Relaxin signaling pathway
rbb04929  GnRH secretion
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05100  Bacterial invasion of epithelial cells
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05146  Amoebiasis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108535636 (PIK3R3)
   04014 Ras signaling pathway
    108535636 (PIK3R3)
   04015 Rap1 signaling pathway
    108535636 (PIK3R3)
   04370 VEGF signaling pathway
    108535636 (PIK3R3)
   04630 JAK-STAT signaling pathway
    108535636 (PIK3R3)
   04668 TNF signaling pathway
    108535636 (PIK3R3)
   04066 HIF-1 signaling pathway
    108535636 (PIK3R3)
   04068 FoxO signaling pathway
    108535636 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    108535636 (PIK3R3)
   04072 Phospholipase D signaling pathway
    108535636 (PIK3R3)
   04071 Sphingolipid signaling pathway
    108535636 (PIK3R3)
   04024 cAMP signaling pathway
    108535636 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    108535636 (PIK3R3)
   04152 AMPK signaling pathway
    108535636 (PIK3R3)
   04150 mTOR signaling pathway
    108535636 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108535636 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    108535636 (PIK3R3)
   04218 Cellular senescence
    108535636 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108535636 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    108535636 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108535636 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108535636 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    108535636 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    108535636 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    108535636 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    108535636 (PIK3R3)
   04660 T cell receptor signaling pathway
    108535636 (PIK3R3)
   04662 B cell receptor signaling pathway
    108535636 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    108535636 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    108535636 (PIK3R3)
   04670 Leukocyte transendothelial migration
    108535636 (PIK3R3)
   04062 Chemokine signaling pathway
    108535636 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108535636 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    108535636 (PIK3R3)
   04929 GnRH secretion
    108535636 (PIK3R3)
   04915 Estrogen signaling pathway
    108535636 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    108535636 (PIK3R3)
   04917 Prolactin signaling pathway
    108535636 (PIK3R3)
   04926 Relaxin signaling pathway
    108535636 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    108535636 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    108535636 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108535636 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108535636 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    108535636 (PIK3R3)
   04722 Neurotrophin signaling pathway
    108535636 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108535636 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    108535636 (PIK3R3)
   04380 Osteoclast differentiation
    108535636 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    108535636 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    108535636 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535636 (PIK3R3)
   05206 MicroRNAs in cancer
    108535636 (PIK3R3)
   05205 Proteoglycans in cancer
    108535636 (PIK3R3)
   05203 Viral carcinogenesis
    108535636 (PIK3R3)
   05230 Central carbon metabolism in cancer
    108535636 (PIK3R3)
   05231 Choline metabolism in cancer
    108535636 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108535636 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108535636 (PIK3R3)
   05212 Pancreatic cancer
    108535636 (PIK3R3)
   05225 Hepatocellular carcinoma
    108535636 (PIK3R3)
   05226 Gastric cancer
    108535636 (PIK3R3)
   05214 Glioma
    108535636 (PIK3R3)
   05221 Acute myeloid leukemia
    108535636 (PIK3R3)
   05220 Chronic myeloid leukemia
    108535636 (PIK3R3)
   05218 Melanoma
    108535636 (PIK3R3)
   05211 Renal cell carcinoma
    108535636 (PIK3R3)
   05215 Prostate cancer
    108535636 (PIK3R3)
   05213 Endometrial cancer
    108535636 (PIK3R3)
   05224 Breast cancer
    108535636 (PIK3R3)
   05222 Small cell lung cancer
    108535636 (PIK3R3)
   05223 Non-small cell lung cancer
    108535636 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108535636 (PIK3R3)
   05017 Spinocerebellar ataxia
    108535636 (PIK3R3)
   05020 Prion disease
    108535636 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108535636 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108535636 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    108535636 (PIK3R3)
   04931 Insulin resistance
    108535636 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108535636 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108535636 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    108535636 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108535636 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    108535636 (PIK3R3)
   05161 Hepatitis B
    108535636 (PIK3R3)
   05160 Hepatitis C
    108535636 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    108535636 (PIK3R3)
   05164 Influenza A
    108535636 (PIK3R3)
   05162 Measles
    108535636 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    108535636 (PIK3R3)
   05163 Human cytomegalovirus infection
    108535636 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108535636 (PIK3R3)
   05169 Epstein-Barr virus infection
    108535636 (PIK3R3)
   05165 Human papillomavirus infection
    108535636 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108535636 (PIK3R3)
   05142 Chagas disease
    108535636 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108535636 (PIK3R3)
   01524 Platinum drug resistance
    108535636 (PIK3R3)
   01522 Endocrine resistance
    108535636 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108535636 (PIK3R3)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    108535636 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Mod_r DUF5638 Fez1
Other DBs
NCBI-GeneID: 108535636
NCBI-ProteinID: XP_017737236
LinkDB
Position
Un
AA seq 507 aa
MGPSRLVHGPRPQGMRSPHRRPGMGWPRPRFPRMFKCSRRRYQQGVQGRTASRAATNPAT
MATGINNTHTDTTIVWIFPPQALPPKPPKPMTSAVTNGMKDSSVSLQDAEWYWGDISREE
VNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVV
ELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKE
YDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIE
RIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLV
WLNHKGVRQKRLNAWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYG
KPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQ
TSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggggccatctcggcttgtccatggccctcggccccagggcatgcgttccccccaccgc
aggccaggtatgggctggcccaggccccggtttcccaggatgttcaagtgtagccgcaga
agataccagcagggtgtccaaggtcgaactgccagcagggcagccaccaatcctgccacc
atggccacgggtatcaacaacacccacactgacaccaccatagtgtggatcttcccacct
caagctcttccaccaaagccacctaagccaatgacttcagcagttacaaatggaatgaag
gacagttctgtttctcttcaggatgcagaatggtactggggggatatttcaagggaggag
gtaaatgacaaattgcgggatatgccagatgggaccttcttggtccgagatgcctcaaca
aaaatgcagggagattatactttgactttgcggaagggaggcaataataagttaataaag
atctatcaccgggatggtaaatatggcttttctgatcctctgacatttaattccgtggtg
gagctcattaaccactatcaccatgaatctcttgctcagtacaatcccaagcttgatgtg
aagctgatgtacccagtgtccagataccaacaggatcagttggtaaaagaagataatatt
gatgcagtaggtaaaaaactgcaagaataccactctcagtatcaagagaagagtaaagag
tatgataggctctatgaagaatatacaagaacatcccaggaaatacagatgaagaggact
gcaatagaagcttttaatgaaacaattaaaatatttgaagagcagtgtcacacacaagaa
caacatagcaaagagtatattgagcgatttcgcagagaggggaatgaaaaggagattgaa
cgaattatgatgaattatgataaattgaaatcacgtctgggagagattcatgatagcaaa
atgcgtctagagcaggatttgaagaaacaagctttggacaaccgagaaatagataagaaa
atgaatagtatcaaacctgacctgatccagctgcgaaagatccgagatcaacaccttgta
tggctcaatcacaaaggggtgagacagaaacgcctgaatgcctggctgggaattaagaat
gaggatgctgatgagaactattttatcaatgaggaagatgaaaacctgccccactatgat
gagaaaacctggtttgttgaggatatcaatcgagtacaagcagaggacttgctttatggg
aaacctgatggtgcattcttaattcgtgagagtagcaagaaaggatgctatgcttgctct
gtggtggctgatggggaagtgaagcactgtgtgatctacagcactgctcggggctatggc
tttgcagagccctacaacctgtacagctctctgaaggagctagtgctccattaccagcag
acatccttggttcagcacaacgactccctcaatgtcaggcttgcctaccctgttcatgca
cagatgccctcgctgtgcagataa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539355
Entry
108539355         CDS       T04641                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04926  Relaxin signaling pathway
rbb04929  GnRH secretion
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05100  Bacterial invasion of epithelial cells
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05146  Amoebiasis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108539355 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108539355 (PIK3CD)
   04014 Ras signaling pathway
    108539355 (PIK3CD)
   04015 Rap1 signaling pathway
    108539355 (PIK3CD)
   04370 VEGF signaling pathway
    108539355 (PIK3CD)
   04630 JAK-STAT signaling pathway
    108539355 (PIK3CD)
   04668 TNF signaling pathway
    108539355 (PIK3CD)
   04066 HIF-1 signaling pathway
    108539355 (PIK3CD)
   04068 FoxO signaling pathway
    108539355 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    108539355 (PIK3CD)
   04072 Phospholipase D signaling pathway
    108539355 (PIK3CD)
   04071 Sphingolipid signaling pathway
    108539355 (PIK3CD)
   04024 cAMP signaling pathway
    108539355 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    108539355 (PIK3CD)
   04152 AMPK signaling pathway
    108539355 (PIK3CD)
   04150 mTOR signaling pathway
    108539355 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108539355 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    108539355 (PIK3CD)
   04218 Cellular senescence
    108539355 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108539355 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    108539355 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108539355 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108539355 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    108539355 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    108539355 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    108539355 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    108539355 (PIK3CD)
   04660 T cell receptor signaling pathway
    108539355 (PIK3CD)
   04662 B cell receptor signaling pathway
    108539355 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    108539355 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    108539355 (PIK3CD)
   04670 Leukocyte transendothelial migration
    108539355 (PIK3CD)
   04062 Chemokine signaling pathway
    108539355 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108539355 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    108539355 (PIK3CD)
   04929 GnRH secretion
    108539355 (PIK3CD)
   04915 Estrogen signaling pathway
    108539355 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    108539355 (PIK3CD)
   04917 Prolactin signaling pathway
    108539355 (PIK3CD)
   04926 Relaxin signaling pathway
    108539355 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    108539355 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    108539355 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108539355 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108539355 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    108539355 (PIK3CD)
   04722 Neurotrophin signaling pathway
    108539355 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108539355 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    108539355 (PIK3CD)
   04380 Osteoclast differentiation
    108539355 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    108539355 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    108539355 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108539355 (PIK3CD)
   05206 MicroRNAs in cancer
    108539355 (PIK3CD)
   05205 Proteoglycans in cancer
    108539355 (PIK3CD)
   05203 Viral carcinogenesis
    108539355 (PIK3CD)
   05230 Central carbon metabolism in cancer
    108539355 (PIK3CD)
   05231 Choline metabolism in cancer
    108539355 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108539355 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108539355 (PIK3CD)
   05212 Pancreatic cancer
    108539355 (PIK3CD)
   05225 Hepatocellular carcinoma
    108539355 (PIK3CD)
   05226 Gastric cancer
    108539355 (PIK3CD)
   05214 Glioma
    108539355 (PIK3CD)
   05221 Acute myeloid leukemia
    108539355 (PIK3CD)
   05220 Chronic myeloid leukemia
    108539355 (PIK3CD)
   05218 Melanoma
    108539355 (PIK3CD)
   05211 Renal cell carcinoma
    108539355 (PIK3CD)
   05215 Prostate cancer
    108539355 (PIK3CD)
   05213 Endometrial cancer
    108539355 (PIK3CD)
   05224 Breast cancer
    108539355 (PIK3CD)
   05222 Small cell lung cancer
    108539355 (PIK3CD)
   05223 Non-small cell lung cancer
    108539355 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108539355 (PIK3CD)
   05017 Spinocerebellar ataxia
    108539355 (PIK3CD)
   05020 Prion disease
    108539355 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108539355 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108539355 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    108539355 (PIK3CD)
   04931 Insulin resistance
    108539355 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108539355 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108539355 (PIK3CD)
   05135 Yersinia infection
    108539355 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    108539355 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108539355 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    108539355 (PIK3CD)
   05161 Hepatitis B
    108539355 (PIK3CD)
   05160 Hepatitis C
    108539355 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    108539355 (PIK3CD)
   05164 Influenza A
    108539355 (PIK3CD)
   05162 Measles
    108539355 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    108539355 (PIK3CD)
   05163 Human cytomegalovirus infection
    108539355 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108539355 (PIK3CD)
   05169 Epstein-Barr virus infection
    108539355 (PIK3CD)
   05165 Human papillomavirus infection
    108539355 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108539355 (PIK3CD)
   05142 Chagas disease
    108539355 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108539355 (PIK3CD)
   01524 Platinum drug resistance
    108539355 (PIK3CD)
   01522 Endocrine resistance
    108539355 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108539355 (PIK3CD)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     108539355 (PIK3CD)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    108539355 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 108539355
NCBI-ProteinID: XP_017743451
UniProt: A0A2K6MH81
LinkDB
Position
Un
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRRQLSWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
TEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKCKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVHSNPNTDSAAALLICLPEVAP
HPVYYPTLEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctgtggcaccgcgcccagtatgagccactcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacggcggagcagcag
gagctggaggatgagcaacggcgtctgtgcgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggtgaccgcgtgaagaagctcatcaactcgcaaatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgtgacccagaagtgaacgactttcgt
gccaagatgtgccagttctgcgaggaggcggctgcccgccggcggcagctgagctgggag
gcctggttgcagtacagcttccccctgcagctggagccctcggctcgaacctgggggcct
ggcaccctgcggctcccaaaccgggccctcctagtcaacgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacagtgttccggcagccgctggtggagcagccggaagactacacg
ctgcaggtgaacggcaggcatgagtacctgtatggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagtgggctgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgctcctcaggtccagaaaccacgt
gccaaaccgcctcccattcctgcaaagaagccctcctctgtgtccctgtggtccctggag
cagccgttctgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggcagggcttttccacggcaacgagatgctgtgcaagacggtgtccagc
acagaggtgagtgtgtgctcggaacctgtgtggaagcagcggctggagttcgacatcaac
atctgcgacctgccccgcatggcccgtctctgcttcgcactgtacgccgtgatcgagaaa
gccaagaaggctcgctccaccaagaagaagtgcaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagactggggaacgctgtctctac
atgtggccctccgtcccagatgagaagggcgagctgctgaaccccacaggcactgtgcat
agtaaccccaacacggatagcgccgccgccctgctcatctgcctgcctgaggtggccccg
caccccgtgtactatcccaccctggagaagatcttggagctggggcggcacagtgagtgt
gtacatgtcaccgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtct
ggggagctctatgagcatgagaaggacctggtgtggaagctgcggcacgaagtccaggag
cacttcccagaggcactagcccggctgctgctggtcaccaagtggaacaagcacgaggat
gtggcccagatgctctacctgctgtgctcctggccggaactgcctgtcctgagcgccctg
gagctgctggacttcagcttccctgattgccatgtaggctccttcgccatcaagtcgctg
cggaaactgacggatgatgagctgttccagtacttgctgcagctggtgcaggtgctaaag
tacgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccgtcagtg
gccctgcgcttcggcctcatcttggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggcactgaacgacttcgtcaag
ctgagctctcagaagacccccaagccccagacgaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagcggcggcagcgtgggcatcatctttaagaac
ggggatgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctccccaccggggac
cgcacaggcctcattgaggtggtactccgctcagacaccattgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggatgccctgctcaactggctgaag
tccaagaacccgggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggccacatacgtgctgggcatcggcgatcggcacagtgacaacatcatg
atccgagagagtgggcagttgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgcgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataatagtgagaaatttgaaaggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggac
tccctggcactggggaaaacagaggaggaggcgctgaagcacttccgagtgaagtttaat
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaag
gacaacaggcagtag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541175
Entry
108541175         CDS       T04641                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04926  Relaxin signaling pathway
rbb04929  GnRH secretion
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05100  Bacterial invasion of epithelial cells
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05146  Amoebiasis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108541175 (PIK3R1)
   04014 Ras signaling pathway
    108541175 (PIK3R1)
   04015 Rap1 signaling pathway
    108541175 (PIK3R1)
   04370 VEGF signaling pathway
    108541175 (PIK3R1)
   04630 JAK-STAT signaling pathway
    108541175 (PIK3R1)
   04668 TNF signaling pathway
    108541175 (PIK3R1)
   04066 HIF-1 signaling pathway
    108541175 (PIK3R1)
   04068 FoxO signaling pathway
    108541175 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    108541175 (PIK3R1)
   04072 Phospholipase D signaling pathway
    108541175 (PIK3R1)
   04071 Sphingolipid signaling pathway
    108541175 (PIK3R1)
   04024 cAMP signaling pathway
    108541175 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    108541175 (PIK3R1)
   04152 AMPK signaling pathway
    108541175 (PIK3R1)
   04150 mTOR signaling pathway
    108541175 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108541175 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    108541175 (PIK3R1)
   04218 Cellular senescence
    108541175 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108541175 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    108541175 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108541175 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108541175 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    108541175 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    108541175 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    108541175 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    108541175 (PIK3R1)
   04660 T cell receptor signaling pathway
    108541175 (PIK3R1)
   04662 B cell receptor signaling pathway
    108541175 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    108541175 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    108541175 (PIK3R1)
   04670 Leukocyte transendothelial migration
    108541175 (PIK3R1)
   04062 Chemokine signaling pathway
    108541175 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108541175 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    108541175 (PIK3R1)
   04929 GnRH secretion
    108541175 (PIK3R1)
   04915 Estrogen signaling pathway
    108541175 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    108541175 (PIK3R1)
   04917 Prolactin signaling pathway
    108541175 (PIK3R1)
   04926 Relaxin signaling pathway
    108541175 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    108541175 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    108541175 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108541175 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108541175 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    108541175 (PIK3R1)
   04722 Neurotrophin signaling pathway
    108541175 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108541175 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    108541175 (PIK3R1)
   04380 Osteoclast differentiation
    108541175 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    108541175 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    108541175 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108541175 (PIK3R1)
   05206 MicroRNAs in cancer
    108541175 (PIK3R1)
   05205 Proteoglycans in cancer
    108541175 (PIK3R1)
   05203 Viral carcinogenesis
    108541175 (PIK3R1)
   05230 Central carbon metabolism in cancer
    108541175 (PIK3R1)
   05231 Choline metabolism in cancer
    108541175 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108541175 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108541175 (PIK3R1)
   05212 Pancreatic cancer
    108541175 (PIK3R1)
   05225 Hepatocellular carcinoma
    108541175 (PIK3R1)
   05226 Gastric cancer
    108541175 (PIK3R1)
   05214 Glioma
    108541175 (PIK3R1)
   05221 Acute myeloid leukemia
    108541175 (PIK3R1)
   05220 Chronic myeloid leukemia
    108541175 (PIK3R1)
   05218 Melanoma
    108541175 (PIK3R1)
   05211 Renal cell carcinoma
    108541175 (PIK3R1)
   05215 Prostate cancer
    108541175 (PIK3R1)
   05213 Endometrial cancer
    108541175 (PIK3R1)
   05224 Breast cancer
    108541175 (PIK3R1)
   05222 Small cell lung cancer
    108541175 (PIK3R1)
   05223 Non-small cell lung cancer
    108541175 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108541175 (PIK3R1)
   05017 Spinocerebellar ataxia
    108541175 (PIK3R1)
   05020 Prion disease
    108541175 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108541175 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108541175 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    108541175 (PIK3R1)
   04931 Insulin resistance
    108541175 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108541175 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108541175 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    108541175 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108541175 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    108541175 (PIK3R1)
   05161 Hepatitis B
    108541175 (PIK3R1)
   05160 Hepatitis C
    108541175 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    108541175 (PIK3R1)
   05164 Influenza A
    108541175 (PIK3R1)
   05162 Measles
    108541175 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    108541175 (PIK3R1)
   05163 Human cytomegalovirus infection
    108541175 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108541175 (PIK3R1)
   05169 Epstein-Barr virus infection
    108541175 (PIK3R1)
   05165 Human papillomavirus infection
    108541175 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108541175 (PIK3R1)
   05142 Chagas disease
    108541175 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108541175 (PIK3R1)
   01524 Platinum drug resistance
    108541175 (PIK3R1)
   01522 Endocrine resistance
    108541175 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108541175 (PIK3R1)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    108541175 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Lant_dehydr_C FANCI_S2 PI_PP_I Mod_r Bap31_Bap29_C
Other DBs
NCBI-GeneID: 108541175
NCBI-ProteinID: XP_017746097
UniProt: A0A2K6JRF6
LinkDB
Position
Un
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTASVDLEMIDVH
ILADAFKRYLLDLPNPVIPAAVYSEMISLAQEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcgctgtatgattataaaaaagaaagagaagaa
gatattgacttgcacttgggtgacatattgactgtaaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggctataat
gaaaccacaggggaaaggggggactttccgggaacttatgtagaatatattggaaggaaa
aaaatctcgcctcccacgccaaagccccggccgcctcggcctcttcctgttgcaccaggt
tcttcaaaaactgaagcagatgttgaacaacaagctttgactctcccggaccttgcagag
cagtttgcccctcctgacgttgccccgcctcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacctggcagaa
ttacgacagcttcttgattgtgatacagcctctgtggacttggaaatgatcgatgtgcac
attttggccgacgctttcaaacgctatctcctggacttaccaaatcctgtcattccagca
gccgtttacagtgaaatgatttctttagctcaagaagtacaaagctccgaagaatatatt
cagctattgaagaagcttattaggtcgcctagcatacctcatcagtattggcttacgctt
cagtatttgttaaaacatttcttcaagctctctcaaacctccagcaaaaatctgttgaat
gcaagagtactctctgaaattttcagccctatgcttttcagattctcagcagccagctct
gataatactgaaaacctcataaaagttatagaaattttaatctcaactgaatggaatgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcaagg
gaagaagtgaatgaaaaacttcgagatacagcagatgggacctttttggtacgagatgcg
tctactaaaatgcatggtgattatactcttacactaaggaaagggggaaataacaaatta
atcaaaatatttcatcgagatgggaaatatggcttctctgacccattaaccttcaattct
gtggttgaattaataaaccactaccggaatgaatctctagctcagtataatcccaagctg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcagtttcaagaaaaaagt
agagaatatgatagattatatgaagaatatacccgtacatcccaggaaatccaaatgaaa
aggacagctattgaagcatttaatgaaaccatcaaaatatttgaagaacagtgccagacc
caggagcgctacagcaaagaatacatagaaaagtttaaacgtgagggcaatgagaaagaa
atacaaaggattatgcataattatgataagttgaagtctcgaatcagtgaaattattgac
agtaggagaagattggaagaagacttgaagaagcaggcagctgagtatcgagaaattgac
aaacgtatgaacagcattaaaccagaccttatccagctgagaaagacgagagaccaatac
ttgatgtggttgactcaaaaaggtgttcggcaaaagaagttgaacgagtggttgggcaat
gaaaacactgaagaccaatattcgctggtggaagatgatgaagatttaccccatcatgat
gagaagacgtggaatgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgaggg
aagcgagatggcacttttcttgtccgggagagcagtaaacagggctgctacgcctgctct
gtagtggtggacggcgaagtaaagcattgtgtcataaacaaaacagcgactggctatggc
tttgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaacac
acctccctcgtgcagcacaacgactccctcaatgtcacactagcctacccagtatatgca
cagcagaggcgatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108544591
Entry
108544591         CDS       T04641                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00562  Inositol phosphate metabolism
rbb01100  Metabolic pathways
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04926  Relaxin signaling pathway
rbb04929  GnRH secretion
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04973  Carbohydrate digestion and absorption
rbb05010  Alzheimer disease
rbb05017  Spinocerebellar ataxia
rbb05020  Prion disease
rbb05100  Bacterial invasion of epithelial cells
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05142  Chagas disease
rbb05146  Amoebiasis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108544591 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108544591 (PIK3CB)
   04014 Ras signaling pathway
    108544591 (PIK3CB)
   04015 Rap1 signaling pathway
    108544591 (PIK3CB)
   04370 VEGF signaling pathway
    108544591 (PIK3CB)
   04630 JAK-STAT signaling pathway
    108544591 (PIK3CB)
   04668 TNF signaling pathway
    108544591 (PIK3CB)
   04066 HIF-1 signaling pathway
    108544591 (PIK3CB)
   04068 FoxO signaling pathway
    108544591 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    108544591 (PIK3CB)
   04072 Phospholipase D signaling pathway
    108544591 (PIK3CB)
   04071 Sphingolipid signaling pathway
    108544591 (PIK3CB)
   04024 cAMP signaling pathway
    108544591 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    108544591 (PIK3CB)
   04152 AMPK signaling pathway
    108544591 (PIK3CB)
   04150 mTOR signaling pathway
    108544591 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108544591 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    108544591 (PIK3CB)
   04218 Cellular senescence
    108544591 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108544591 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    108544591 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108544591 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108544591 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    108544591 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    108544591 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    108544591 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    108544591 (PIK3CB)
   04660 T cell receptor signaling pathway
    108544591 (PIK3CB)
   04662 B cell receptor signaling pathway
    108544591 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    108544591 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    108544591 (PIK3CB)
   04670 Leukocyte transendothelial migration
    108544591 (PIK3CB)
   04062 Chemokine signaling pathway
    108544591 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108544591 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    108544591 (PIK3CB)
   04929 GnRH secretion
    108544591 (PIK3CB)
   04915 Estrogen signaling pathway
    108544591 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    108544591 (PIK3CB)
   04917 Prolactin signaling pathway
    108544591 (PIK3CB)
   04926 Relaxin signaling pathway
    108544591 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    108544591 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    108544591 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108544591 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108544591 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    108544591 (PIK3CB)
   04722 Neurotrophin signaling pathway
    108544591 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108544591 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    108544591 (PIK3CB)
   04380 Osteoclast differentiation
    108544591 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    108544591 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    108544591 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108544591 (PIK3CB)
   05206 MicroRNAs in cancer
    108544591 (PIK3CB)
   05205 Proteoglycans in cancer
    108544591 (PIK3CB)
   05203 Viral carcinogenesis
    108544591 (PIK3CB)
   05230 Central carbon metabolism in cancer
    108544591 (PIK3CB)
   05231 Choline metabolism in cancer
    108544591 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108544591 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108544591 (PIK3CB)
   05212 Pancreatic cancer
    108544591 (PIK3CB)
   05225 Hepatocellular carcinoma
    108544591 (PIK3CB)
   05226 Gastric cancer
    108544591 (PIK3CB)
   05214 Glioma
    108544591 (PIK3CB)
   05221 Acute myeloid leukemia
    108544591 (PIK3CB)
   05220 Chronic myeloid leukemia
    108544591 (PIK3CB)
   05218 Melanoma
    108544591 (PIK3CB)
   05211 Renal cell carcinoma
    108544591 (PIK3CB)
   05215 Prostate cancer
    108544591 (PIK3CB)
   05213 Endometrial cancer
    108544591 (PIK3CB)
   05224 Breast cancer
    108544591 (PIK3CB)
   05222 Small cell lung cancer
    108544591 (PIK3CB)
   05223 Non-small cell lung cancer
    108544591 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108544591 (PIK3CB)
   05017 Spinocerebellar ataxia
    108544591 (PIK3CB)
   05020 Prion disease
    108544591 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108544591 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108544591 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    108544591 (PIK3CB)
   04931 Insulin resistance
    108544591 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108544591 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108544591 (PIK3CB)
   05135 Yersinia infection
    108544591 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    108544591 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108544591 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    108544591 (PIK3CB)
   05161 Hepatitis B
    108544591 (PIK3CB)
   05160 Hepatitis C
    108544591 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    108544591 (PIK3CB)
   05164 Influenza A
    108544591 (PIK3CB)
   05162 Measles
    108544591 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    108544591 (PIK3CB)
   05163 Human cytomegalovirus infection
    108544591 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108544591 (PIK3CB)
   05169 Epstein-Barr virus infection
    108544591 (PIK3CB)
   05165 Human papillomavirus infection
    108544591 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108544591 (PIK3CB)
   05142 Chagas disease
    108544591 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108544591 (PIK3CB)
   01524 Platinum drug resistance
    108544591 (PIK3CB)
   01522 Endocrine resistance
    108544591 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108544591 (PIK3CB)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     108544591 (PIK3CB)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    108544591 (PIK3CB)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 Tom37_C
Other DBs
NCBI-GeneID: 108544591
NCBI-ProteinID: XP_017751308
LinkDB
Position
Un
AA seq 980 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGX
KIRLKIGVLIGKGVLLCSLFLDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDY
VLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAINR
NSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCK
TIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAIYAVLDKVKTKKSTKNINPSKYQ
TIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIMLHSWSSFPDELEEMLNPMGTVQTNPYTE
NATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDP
LSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREA
LELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALG
NRRIGQFLFWHLSFGVGNLFFQVEALNKLKTLNSLIKLNAVKLNRAKGKEAMHTCLKQSA
YREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVYNNKVFGEDSVGVIFKNGDDL
RQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNV
AAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKT
GQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAY
LILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALR
ESWTTKVNWMAHTVRKDYRS
NT seq 2943 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcggtg
gattcacagatagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaagcagatgttatgg
aagcaagttcacaattacccaatgttcaacctccttatggatattgactcctatatgttt
gcatgtgtgaaccagactgctgtatatgaggagcttgaagatgaaacacgaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccagggnng
aaaattagactcaaaattggagtccttataggaaaaggggttctcctctgctccctgttc
ctggatgtgtttagctttcaagtatctcctaatatgaatcctatcaaagtaaatgaattg
gcaatccaaaaacgtttgactattcatgggaaggaagatgaagttagcccctatgattat
gtgttgcaagtcagtgggagagtagaatatgtttttggtgatcatccactaattcagttc
cagtatatccgaaactgtgtaatgaacaggaccctgccccattttatacttgtggaatgc
tgcaagatcaagaaaatgtatgaacaggaaatgattgccatagaggctgccataaatcgg
aattcatctaaccttcctcttccattaccaccaaagaaaacgcgaattatttctcatgtt
tgggaaaataacaaccctttccaaattgtcttggttaagggaaataaacttaacacagag
gaaactgtaaaagttcatgtcagggctggtctttttcatggtactgagctcctgtgtaaa
accatcgtaagctcagaggtatcagggaaaaatgatcatatttggaatgaaccactggaa
tttgatattaatatttgtgacttaccaagaatggctcgattatgttttgctatttatgct
gttttggataaagtaaaaacgaagaaatcaacgaaaaatattaatccctctaaatatcag
accatcagaaaagctggaaaagtgcattatcctgtagcgtgggtaaatacgatggttttt
gactttaaaggacaattgagaactggagacataatgttacacagctggtcttcatttcct
gatgaacttgaagaaatgttgaatccaatgggaactgttcaaacaaatccatatactgaa
aatgcaacagctttgcatattaaatttccagagaataaaaaacaaccttattattaccct
cccttcgataagattattgaaaaggcagctgagattgcaagcagtgatagtgctaatgtg
tcaagtcgaggtggaaaaaagtttcttcctgtattgaaagaaatcttggacagggatccc
ttgtctcaactgtgtgaaaatgaaatggatcttatttggactttgcgacaagactgccga
gagattttcccacaatcactgccaaaattactgctgtcaatcaagtggaataaacttgag
gatgttgctcagcttcaggcgctgcttcagatttggcctaaactgcccccccgggaggcc
ctagagcttctggatttcaactatccagaccagtacgttcgagaatatgctgtaggctgc
ctgcgacagatgagtgatgaagaactttctcagtatcttttacaactggtgcaagtttta
aaatatgagccttttcttgattgtgccctctctagattcctattagaaagagcacttggt
aatcggaggatagggcagtttctattttggcatcttagttttggtgtggggaacttattt
tttcaggttgaagcactcaataagttaaaaactttaaatagtttaatcaaactgaatgca
gtgaagttaaacagagccaaagggaaggaggccatgcatacctgtttaaaacagagtgct
taccgggaagccctctctgacctgcagtcacccctgaacccatgtgttatcctctcggaa
ctctatgttgaaaagtgcaaatacatggattccaaaatgaagcctttgtggctggtatac
aataacaaggtatttggtgaggattcagttggagtgatttttaaaaatggtgatgattta
cgacaggatatgttgacactccagatgttgcgcttgatggatttactctggaaagaagct
ggtttggatcttcggatgttgccttatggctgtttagcaacaggagatcgctctggcctc
attgaagttgtgagcacctctgaaacaattgctgacattcagctgaacagtagcaatgtg
gctgctgcagcagccttcaacaaagatgcccttctgaactggcttaaagaatacaattct
ggggatgacctggaccgagccattgaggaatttacactgtcctgtgctggctactgtgta
gcttcttatgtccttgggattggtgacagacatagtgacaacatcatggtcaaaaaaact
ggccagctcttccacattgactttggacatattcttggaaatttcaaatctaagtttggc
attaaaagggagcgagtgccttttattcttacctatgatttcatccatgtcattcaacaa
ggaaaaacaggaaatacagaaaagtttggccggttccgccagtgttgtgaggatgcatat
ctgattttacgacggcatgggaatctcttcatcactctctttgcgctgatgttgactgca
gggcttcctgagctcacatcagtcaaggatatacagtatcttaaggactctcttgcatta
gggaagagtgaagaagaagcactcaaacagtttaagcaaaaatttgatgaggcgctcagg
gaaagctggactactaaagtgaactggatggcccacacagttcggaaagactacagatct
taa

DBGET integrated database retrieval system