KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108533135
Entry
108533135         CDS       T04641                                 

Gene name
SMAD4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04310  Wnt signaling pathway
rbb04350  TGF-beta signaling pathway
rbb04371  Apelin signaling pathway
rbb04390  Hippo signaling pathway
rbb04520  Adherens junction
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04659  Th17 cell differentiation
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05161  Hepatitis B
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05220  Chronic myeloid leukemia
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108533135 (SMAD4)
   04350 TGF-beta signaling pathway
    108533135 (SMAD4)
   04390 Hippo signaling pathway
    108533135 (SMAD4)
   04371 Apelin signaling pathway
    108533135 (SMAD4)
   04068 FoxO signaling pathway
    108533135 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108533135 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108533135 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    108533135 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108533135 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108533135 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108533135 (SMAD4)
   05212 Pancreatic cancer
    108533135 (SMAD4)
   05225 Hepatocellular carcinoma
    108533135 (SMAD4)
   05226 Gastric cancer
    108533135 (SMAD4)
   05220 Chronic myeloid leukemia
    108533135 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108533135 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108533135 (SMAD4)
   05161 Hepatitis B
    108533135 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 108533135
NCBI-ProteinID: XP_017733041
UniProt: A0A2K6L5S1
LinkDB
Position
Un
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPSIPVASTSQPASILGGSHTEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg
agacttcaggtggctggccggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat
gaatatgttcatgactttgagggacagccatcgttgtccactgaaggacattcgattcaa
accatccagcatccaccaagtaatcgtgcgtcgacagagacatacagcaccccagctctg
ttagccccatctgagtctaatgctaccagcactgccaactttcccagcattcctgtggct
tccacaagtcagcctgccagtatactggggggcagccatactgaaggactgttgcagata
gcatcagggcctcagccaggacagcagcagaacggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccatgcggtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgacagatgcagcagcaggcggccactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggcccgggatcagtaggtggaatagctcca
gctatcagtctgtcagctgctgctggaatcggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaaaggctggggaccagattacccaagacagagcatcaaagaa
acaccttgctggattgaaattcacttacaccgggccctccagctcctagacgaagtactt
cacaccatgccgattgcagacccacaacctttagactga

DBGET integrated database retrieval system