KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108533452
Entry
108533452         CDS       T04641                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04370  VEGF signaling pathway
rbb04510  Focal adhesion
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05219  Bladder cancer
rbb05323  Rheumatoid arthritis
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108533452 (VEGFA)
   04014 Ras signaling pathway
    108533452 (VEGFA)
   04015 Rap1 signaling pathway
    108533452 (VEGFA)
   04370 VEGF signaling pathway
    108533452 (VEGFA)
   04066 HIF-1 signaling pathway
    108533452 (VEGFA)
   04020 Calcium signaling pathway
    108533452 (VEGFA)
   04151 PI3K-Akt signaling pathway
    108533452 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108533452 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108533452 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108533452 (VEGFA)
   05206 MicroRNAs in cancer
    108533452 (VEGFA)
   05205 Proteoglycans in cancer
    108533452 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108533452 (VEGFA)
   05211 Renal cell carcinoma
    108533452 (VEGFA)
   05219 Bladder cancer
    108533452 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108533452 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108533452 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108533452 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108533452 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108533452 (VEGFA)
   05165 Human papillomavirus infection
    108533452 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108533452 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108533452 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108533452 (VEGFA)
Cytokines and growth factors [BR:rbb04052]
 Growth factors
  Growth factors (RTK binding)
   108533452 (VEGFA)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108533452 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 108533452
NCBI-ProteinID: XP_017733625
LinkDB
Position
Un
AA seq 215 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctgtacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagattgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgtgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system