KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108533952Help
Entry
108533952         CDS       T04641                                 

Gene name
PCGF2
Definition
(RefSeq) polycomb group ring finger 2
  KO
K11460  polycomb group RING finger protein 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108533952 (PCGF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108533952 (PCGF2)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     108533952 (PCGF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 zf-RING_UBOX zf-C3HC4_4 Prok-RING_4 zf-Nse zf-ANAPC11 Rad60-SLD zf-RING_10 FAP
Motif
Other DBs
NCBI-GeneID: 108533952
NCBI-ProteinID: XP_017734482
UniProt: A0A2K6KMI9
LinkDB All DBs
Position
Un
AA seq 344 aa AA seqDB search
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALSDDEIVSLSIEFYEGARDREEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKF
LRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLAT
VPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTASGATTAANGGTSNCLQTPSSTSRGRKMTVNGAPVPPLT
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggactacacggatcaaaatcacagagctgaacccccacctcatgtgtgccctc
tgcggggggtacttcattgacgccaccactatcgtggagtgcctgcattccttctgcaaa
acctgcatcgtgcgctacctggagaccaacaaatactgccccatgtgtgatgtgcaggtc
cataaaacccggccgctgctgagcatcaggtctgacaaaacccttcaagacattgtctac
aaattggtccctgggctttttaaagatgagatgaaacggcggcgggatttctatgcagcg
taccccctgacggaggtccccaacggctccaatgaggaccgcggcgaggtcttggagcag
gagaagggggctctgagcgatgatgagattgtcagcctctccatcgaattctacgaaggt
gccagggaccgggaggagaagaagggccccctggagaatggggatggggacaaagagaaa
acaggggtgcgcttcctgcgatgcccagcagccatgaccgtcatgcatcttgccaagttt
ctccgcaacaagatggatgtgcccagcaagtacaaggtggaggttctgtacgaggacgag
ccactgaaggaatactacaccctcatggacatcgcctacatctacccctggcggcggaac
gggcctcttcccctcaagtaccgggtccagccagcctgcaagcggctcaccctagccacg
gtgcccaccccctccgagggcaccaacaccagcggggcatccgagtgtgagtcagtcagc
gacaaggctcccagccctgccaccctgccagccacctcctcctccctgcccagcccagcc
accccatcccatggctctcccagctcccatgggcctccagccacccaccctacctccccc
actcccccttcgacagccagtggggccaccacagctgccaacgggggtacctcgaactgc
ctgcagacaccatcctccaccagcagagggcgcaagatgactgtcaacggtgctcccgtg
ccccccttaacttga

DBGET integrated database retrieval system