KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534154Help
Entry
108534154         CDS       T04641                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00052  Galactose metabolism
rbb00500  Starch and sucrose metabolism
rbb01100  Metabolic pathways
rbb04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108534154 (GAA)
   00500 Starch and sucrose metabolism
    108534154 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108534154 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108534154 (GAA)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108534154 (GAA)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108534154 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108534154
NCBI-ProteinID: XP_017734806
LinkDB All DBs
Position
Un
AA seq 971 aa AA seqDB search
MEAGDEAAGLQELSGSSPTMGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRE
LSGSSSVLEETRPAHQQGARRPGPQDAQAHPGCPRAVPTQCDVPPNSRFDCAPDKAITQE
QCEARGCCYIPAKQGLRRAQMGQSWCFFPPSYPSYKLENLSASEMGYTATLTRTTPTFFP
KDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPRVPSRALSPLYSVEFSEEPFGVI
VRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNR
DLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYI
FLGPEPKSVVRQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQ
WNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYVMIVDPAISSSGPAGSYRPYDEG
LRRGVFITNETGQPLIGQVWPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNE
PSNFIRGSEDGCPNNELEKPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAI
ASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLAASVPEILQFNLLGVPL
VGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTL
RYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKA
EVTGYFPSGTWYDLETVPIEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAG
YIIPLQGPGLTTTESRQQPMALAVALTKGGEAQGELFWDDGESLEVLERGAYTQVLFLAR
SNTIMNELVHVTSEGAGLQLQKVTVLGVATAPQQVLSNGAPVSNFTYSPDTKVLDIPVSL
LMGEQFLISWS
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggaggccggggatgaggcagcaggcctccaggagctgtccgggtcatctcctaccatg
ggagtgaggcacccgccctgctcccaccggctgctggccgtctgcgccctcgtgtccttg
gccaccgctgcgctcctggggcacatcctcctccatgatttcctgctggttccccgagag
ctgagtggatcctcctcggtcctggaggagactcgcccagctcaccagcagggagccagg
aggccagggccccaggatgcccaggcacaccccggctgtcccagagcagtgcccacacag
tgcgacgtccccccgaacagccgcttcgactgtgcccctgacaaggccatcacccaggaa
cagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggctgcggagagcccag
atgggacagtcctggtgcttcttcccacccagctaccccagctacaagctggagaacctg
agcgcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttcccc
aaggacatcctgaccttgcggctggacgtgatgatggagactgagaaccgcctccacttc
acaatcaaagatcccgctaacaggcgctacgaggtgcccttggagaccccgcgtgtcccc
agccgggcactgtccccactctacagcgtggagttctccgaggagcccttcggggtgatt
gtgcgccggcagctggacggccgtgtgctgctgaacacgacggtggcgcccctgttcttt
gcggaccagttccttcagttgtccacctcactgccctcgcagtacatcacaggactcgcc
gagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgg
gacctcgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctg
gaggatggcgggtcggcacatggggtgttcctgctgaacagcaatgccatggatgtggtc
ctgcagccgagccctgcccttacctggaggtcgacaggtgggatcctggatgtgtacatc
ttcctgggcccggagcccaagagcgtggtgcggcagtacctggatgttgtgggatacccg
ttcatgccgccgtactggggcctgggcttccacctgtgccgctggggctactcctccacc
gccatcacccgccaggtggtagagaacatgaccagggcccacttccccctggacgtccag
tggaacgacttggactacatggactcccggagggacttcacgttcaacaaggacggcttc
cgggacttcccagccatggtgcaggaactgcaccagggcggccggcgctacgtgatgatt
gtggatcctgccatcagcagctcgggccctgccgggagctacagaccgtacgacgagggt
ctgcggaggggggttttcatcaccaacgagaccggccagccgctgattgggcaggtgtgg
cctgggtccactgccttccccgacttcaccaaccctgcagccctggcctggtgggaggac
atggtggctgagttccatgaccaggtgccctttgatggcatgtggattgacatgaacgag
ccttccaacttcatcaggggctctgaggatggctgccccaacaatgagctggagaagccg
ccctacgtgcctggagtggttggggggaccctccaggcggccaccatctgtgcctccagc
caccagttcctctccacacactacaacctgcacaacctctacggcctgactgaagccatc
gcctcccacagggcactggtgaaggctcgggggacacgcccatttgtgatctcccgctcg
acctttgctggccacggccgatatgccggccactggacgggggacgtgtggagctcctgg
gagcagctcgccgcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctg
gtcggggccgacgtctgtggcttcctgggcaacacctcagaggagctgtgtgtgcgctgg
acccagctgggggccttttacccctttatgcggaaccacaacggcctgctcaatctgccc
caggagccatacagtttcagcgagccggcccagcaggccatgaggaaggccctcaccctg
cgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgctggggag
accgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggac
caccagctcctgtggggggaggccctgctcatcaccccagtgctgcaggccgggaaggcc
gaagtgaccggctacttcccctcaggcacatggtacgacctggagacggtgccaatagag
gcccttggcagcctcccgcccccacctgcagctccccgtgagccagccatccacagcgag
gggcagtgggtgacgctgccagcccccctggacaccatcaacgtccacctccgggctggg
tacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatg
gccctggctgtggctctgaccaagggtggggaggcccaaggggagctgttctgggacgat
ggagagagcctggaagtgctggagcgaggggcctacacacaggtcctattcctggccagg
agtaacacgatcatgaatgagctggtacatgtgaccagcgagggggctggcctgcagctg
cagaaggtgaccgtcctgggcgtggccacagcgccccagcaggtcctctccaacggtgcc
cctgtctccaacttcacctacagccccgacaccaaggtcctggacatccctgtctcgctg
ttgatgggagagcagtttctcatcagctggtcttag

DBGET integrated database retrieval system