KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534593
Entry
108534593         CDS       T04641                                 

Gene name
C3
Definition
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04080  Neuroactive ligand-receptor interaction
rbb04145  Phagosome
rbb04610  Complement and coagulation cascades
rbb04613  Neutrophil extracellular trap formation
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05203  Viral carcinogenesis
rbb05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108534593 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108534593 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    108534593 (C3)
   04613 Neutrophil extracellular trap formation
    108534593 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    108534593 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    108534593 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108534593 (C3)
   05134 Legionellosis
    108534593 (C3)
   05150 Staphylococcus aureus infection
    108534593 (C3)
   05152 Tuberculosis
    108534593 (C3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108534593 (C3)
   05168 Herpes simplex virus 1 infection
    108534593 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108534593 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108534593 (C3)
   05142 Chagas disease
    108534593 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rbb01002]
    108534593 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108534593 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108534593 (C3)
Peptidases and inhibitors [BR:rbb01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   108534593 (C3)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108534593 (C3)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108534593 (C3)
SSDB
Motif
Pfam: TED_complement MG1 A2M_recep A2M MG4 NTR A2M_BRD ANATO MG2 MG3
Other DBs
NCBI-GeneID: 108534593
NCBI-ProteinID: XP_017735537
LinkDB
Position
Un
AA seq 1617 aa
MGPTSGPSLLLLLLIHLPLALGTPMYSMITPNVLRLESEETVVLEAHDAKGDVPVTVTVH
DFPGKKLVLSSEKTVLTPATSHMGNVTIRIPANKEFKSEKGHNKFVTVQATFGAQVVEKV
VLVSLQSGYLFIQTDKTIYTPGSTVLCRIFTVNHKLLPVGRTVMVNIEVPARGGPRGSRG
TGSGEAKRSRRDRSTGRGAVAEIQSPPCLPRRFLYGKKVEGTAFVIFGIQDGEQRISLPE
SLKRIPIEDGSGDAVLSRKVLLDGVQNPRPEDLVGKSLYVSVTVILHSGSDMVQAERSGI
PIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDAVQSLTQGDGV
AKLSINTHPSQKPLSITVRTKKRELSEAEQATRTMEAQPYSTVGNSNNYLHLSVPRAELR
PGETLNVNFLLRMDRAHQAKIRYYTYLIMNKGKLLKVGRQVREPGQDLVVLPLSITTDFI
PSFRLVAYYTLIGASGQREVVADSVWVDVKDTCVGSLVVKSGQSEDRQPSPGQQMTLKIE
GDHGARVGLVAVDKGVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTF
ASSSGQQTAQRAELQCPQPAARRRRSVQLAEKRMDKVGKYPKELRKCCEHGMRENPMRFS
CQRRTRYITLDEACKKAFLDCCNYITELRRQHARASHLGLARSNLDEDIIAEENIVSRSE
FPESWLWKIEELKEPPKNGISTKLMNIFLKDSITTWEILAVSLSDKKGICVADPFEVTVM
QDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNEELKVRVELLHNPAFCSLATAKRRHQQTV
TIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHFFISDGVRKSLKVVPEGIRMNKTVAVRT
LDPERLGQEGVQREDVPPADLSDQVPDTESETRILLQGTPVAQMTEDAIDAERLKHLIVT
PSGCGEQNMISMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAY
AAFLNRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIH
QEMTGGFRNTNEKDMALTAFVLISLQEAKEICEEQVNSLPGSITKAGDFLEANYMNLQRS
YTVAIAAYALAQMGRLKGPLLNKFLTTAKDKNRWEEPGQQLYNVEATSYALLALLQLKDF
DFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDVPDHKELNLDVSLQLPSRSSK
ITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKGQLTCNKFDLKVT
IKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFVPDTDDLKQLANGVD
RYIAKYELDKAFSDRNTLIIYLDKVSHSEDECIAFKVHQYFNVELIQPGAVKVYAYYNLA
ESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKLDDKVTLEERLDKACEPGVDYVYK
TRLVKAQLSNDFDEYIMAIEQIIKSGSDEVQVGQQRTFVSPIKCREALKLEERKHYLMWG
LSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTENMVVFGCPN
NT seq 4854 nt   +upstreamnt  +downstreamnt
atgggacccacctcaggtcccagcctgctgctcctgctactaatccacctccccctggct
ctggggactcccatgtactctatgatcacccccaacgtcttgcggctggagagtgaggag
accgtggtgctggaggcccacgacgcgaaaggggatgttccggtcactgtcactgtccac
gacttcccaggcaaaaaactagtgctgtccagtgagaagaccgtgctgacccctgccacc
agccacatgggcaacgtcaccatcaggatcccagccaacaaggagttcaagtcagaaaag
gggcacaacaagttcgtgacagtgcaggccaccttcggggcccaagtggtggagaaggtg
gtactagtcagccttcagagcgggtacctcttcatccagacagacaagaccatctacacc
cctggctccacagttctctgtcggatcttcaccgtcaaccacaagctgctacccgtgggc
cggacggtcatggtcaacattgaggtaccagccagagggggccccaggggcagcaggggc
acaggctcaggagaggcaaagagatcgagacgagacaggagcaccggaagaggtgcagtg
gcagagatacagagccctccttgtctgccccgtaggttcctctatgggaagaaagtggag
ggaactgcctttgtcatcttcgggatccaggatggcgagcagaggatttccctgcctgaa
tccctcaagcgcatcccgattgaggatggctcaggggacgccgtgctgagccggaaggta
ctgctggacggggtgcagaacccccgaccggaagacctggtggggaagtctttgtatgtg
tctgtcaccgttatcttgcactcaggaagtgacatggtgcaggcggaacgcagcgggatc
cccatcgtgacctctccctaccagatccacttcaccaagacgcccaagtacttcaaacca
ggaatgccctttgacctcatggtgttcgtgacgaaccccgatggctctccagcctaccga
gtccccgtggcagtccagggtgaggacgctgtgcagtctctaacccagggagacggcgtg
gcaaaactcagcatcaacacacaccccagccagaagcctttgagcatcacggtgcgcacg
aagaagcgggagctctcggaggcagagcaggctaccaggaccatggaggctcagccctac
agcaccgtgggcaactccaacaattacctgcatctctcagtgccacgtgcagagctcaga
cccggggagaccctcaacgtcaacttcctcctgcgaatggaccgcgcccaccaggccaag
atccgctactacacctacctgatcatgaacaagggcaagctgttgaaggtgggacgccag
gtgcgagagcccggccaggacctggtggtgctgcccctgtccatcaccaccgacttcatc
ccttccttccgcctggtggcgtactacacgctgatcggcgccagcggccagagggaggtg
gtggccgattccgtgtgggtggacgtcaaggacacttgcgtgggctcgctggtggtaaaa
agcggccagtcagaagacaggcagccttcacctgggcagcagatgaccctgaagatagag
ggtgaccacggggcccgggtgggactggtggctgtggacaagggcgtgtttgtgctgaat
aagaagaacaagctgacgcagagtaagatctgggacgtggtggagaaggcagacatcggc
tgcaccccaggcagtgggaaggactacgccggtgtcttctcggatgcaggcctgaccttt
gccagcagcagtggccagcagaccgcccagagggcagaacttcagtgcccccagccagcc
gcccgccgacgccgttccgtgcagctcgcggagaagagaatggacaaagtcggcaagtac
cccaaggagctgcgcaagtgctgcgagcatggcatgcgggagaaccccatgaggttctcg
tgccagcgccggacccgttacatcaccctggacgaggcgtgcaagaaggccttcctggac
tgctgcaactacatcacagagctgcggcggcagcacgcgcgggccagtcacctgggcctg
gccaggagtaacctggatgaggacatcatcgcagaggagaatattgtttcccgaagtgag
ttcccagagagctggctgtggaagattgaagagttgaaagagccaccgaaaaatggaatc
tccacgaagctcatgaatatatttttgaaagattccatcaccacatgggagattctggct
gtgagcttgtcagacaagaaagggatctgtgtggcagaccccttcgaggtcacagtaatg
caagacttcttcatcgacctgcggctaccctactctgttgttcgaaacgagcaggtggaa
atccgagccgttctctacaattaccggcagaacgaagagctcaaggtgagggtggaacta
ctccacaatccagccttctgcagcctggccaccgccaagaggcgtcaccagcagaccgta
accatcccccccaagtcctcgctgtccgttccttatgtcatcgtgcccctaaagaccggc
ctgcaggaagtagaagtcaaggctgccgtctaccattttttcatcagtgacggtgtcagg
aagtccctgaaggtcgtgccggaaggaatcagaatgaacaaaactgtggctgttcgcacg
ctggatccagaacgcctgggccaagaaggagtgcagagagaggacgtcccacctgcagac
ctcagtgaccaagtcccggacacggagtctgagaccagaattctcctgcaagggaccccc
gtggcccagatgacagaggatgccatcgatgcggaacggctgaaacatctcatcgtgacc
ccctcgggctgcggggaacagaacatgatcagcatgacgcccacagtcatcgctgtgcat
tatctggatgaaacggaacagtgggagaagttcggcctagagaagcggcagggggccttg
gagctcatcaagaaggggtatacccagcagctggccttcagacaacccagctctgcctat
gcggccttcctgaaccgggcacccagcacctggctgaccgcctacgtggtcaaggtcttc
tctctggctgtcaacctcattgccatagactcccaggtcctctgcggggctgttaaatgg
ctgatcctggagaagcagaagccggatggagtcttccaggaggatgcgcccgtgatacat
caagaaatgactggtggattccggaacaccaacgagaaagacatggccctcacggccttt
gttctcatctcgctgcaagaggctaaagagatttgtgaggagcaggtcaacagcctgcca
ggcagcatcactaaggcaggagacttccttgaagccaactacatgaacctacagagatcc
tacactgtggccattgctgcctatgccctggcccagatgggcaggctaaagggacctctc
ctcaacaaatttctgaccacagccaaagataagaaccgctgggaggagcctggtcagcag
ctctacaatgtggaggccacatcctatgccctcttggccctactgcagctaaaagacttt
gactttgtgcctcccgtcgtgcgttggctcaatgaacagagatactacggtggtggctat
ggctctacccaggccaccttcatggtgttccaagccttggctcaataccaaaaggatgtc
cctgaccataaggaactgaacctggatgtgtccctccaactgcccagtcgcagctccaag
atcacccaccgtatccactgggaatctgccagcctcctgcgatcagaagagaccaaggaa
aatgagggtttcacagtcacagctgaaggaaaaggccaaggcaccttgtcggtggtgaca
atgtaccatgctaaggccaaaggtcaactcacctgtaataaattcgacctcaaggtcacc
ataaagccagcaccggaaacagaaaagaggcctcaggatgccaagaacactatgatcctt
gagatctgtaccaggtaccggggagaccaggatgccactatgtctatactggacatatcc
atgatgactggcttcgttccagacacagatgacctcaagcagctggcaaacggcgttgac
agatacatcgccaagtatgagctggacaaagccttctccgataggaacaccctcatcatc
tacctggacaaggtctcacactctgaggatgagtgtatagctttcaaagttcaccaatat
tttaatgtagagcttatccagcctggtgcagtcaaggtctacgcctattacaacctggcg
gaaagctgtacccggttctaccacccggaaaaggaggatggaaagctgaacaagctctgt
cgtgatgaactgtgccgctgtgctgaggagaattgcttcatacaaaagttggatgacaag
gtcaccctggaagaacggctggacaaggcctgtgagccaggagtggactatgtgtacaag
acccgactggtcaaggcccagctgtccaatgactttgacgagtacatcatggccattgag
cagatcatcaagtcaggctcggatgaggtgcaggttgggcaacagcgcacgttcgtcagc
cccatcaagtgcagggaagccctgaagctggaggagaggaaacactacctcatgtggggt
ctctcctcggatttctggggagagaaacccaacctcagctacatcattgggaaggacacc
tgggtggagcactggcccgaggaggacgaatgccaagacgaagagaaccagaaacaatgc
caggacctcggcgccttcaccgagaacatggttgtctttgggtgccctaactga

DBGET integrated database retrieval system