KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534725Help
Entry
108534725         CDS       T04641                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb05164  Influenza A
rbb05202  Transcriptional misregulation in cancer
rbb05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    108534725 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    108534725 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    108534725 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rbb01002]
    108534725 (TMPRSS2)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108534725 (TMPRSS2)
Peptidases [BR:rbb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108534725 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR SRCR DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 108534725
NCBI-ProteinID: XP_017735714
UniProt: A0A2K6MMI8
LinkDB All DBs
Position
Un
AA seq 532 aa AA seqDB search
MPPAPPGGESGCEERGAAGHTEHSRYLSLLDAVDKSKMALNSGSPPGVGPYYENRGYQPE
NPYPAQPTVAPNVYEVHPAQYYLYPVPQYTPRVLTHASNPTVCTQPKSPSGTVCTSKTKK
ALCVAMTLGAVLVGAALAAGLLWKFMGSKCSDSGIECDSSGTCISSSNWCDGVSHCPSGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCRDDWNENYGRVACRDMGYKNSFYSSQGIAVN
SGATSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVRSNSSLQSRIVGGQNAF
PGAWPWQVSLHVQNIHVCGGSIITPEWIVTAAHCVEKPLNNPWQWTAFAGILRQSFMLYE
KGHRVEKVISHPNYDSKTKNNDIALMKLHTPLTFNELVKPVCLPNPGMMLEPEQHCWISG
WGATQEKGKTSDVLNAAMVPLIEPWRCNSKYVYDSLITPAMICAGFLQGTVDSCQGDSGG
PLVTLKNDVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYRQMRADDSSS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgccccctgccccgcccggaggtgaaagcgggtgtgaggagcgcggcgcggcaggtcat
actgaacattccagatacctatcattactcgatgctgttgataaaagcaagatggctttg
aactcagggtcaccgccaggtgttggaccttactatgaaaaccgtggataccaaccggaa
aacccctatcctgcacagcccactgtggcccccaatgtctacgaggtgcatccggctcag
tactacctgtaccccgtaccccagtacaccccgagggtcctgacgcatgcttccaacccc
accgtctgcacgcagcccaaatccccgtcggggacagtgtgcacctcaaagactaagaaa
gcactgtgcgtcgccatgaccctgggggccgtcctcgtgggagctgcgctggccgctggc
ctgctctggaagttcatgggcagcaagtgctccgactctgggatagagtgcgactcctca
ggtacctgcatcagctcctctaactggtgcgatggcgtgtcacactgccccagcggggag
gacgagaaccggtgtgttcgcctctatggaccaaacttcatccttcaggtgtactcatct
cagaggaagtcgtggcaccctgtatgccgagacgactggaatgagaattacgggcgggtg
gcctgcagggacatgggctataagaatagtttttactctagccaaggaatagcggttaac
agtggagccaccagctttatgaaactgaacacaagtgccggcaatgtcgatatctataaa
aaattgtaccacagtgatgcctgttcttcaaaagcagtggtttctttacgctgtatagct
tgtggggtccgctcaaactcaagcctccagagcaggatcgtgggcggccagaacgcgttc
ccgggggcctggccctggcaggtcagcctgcacgtccagaacatccatgtgtgtggaggc
tccatcatcacccctgagtggatcgtgacagctgcccactgcgtggaaaaacctcttaac
aatccgtggcaatggacggcatttgcggggattttgagacaatctttcatgctctatgaa
aaaggacaccgagtagaaaaagtgatttctcatccaaattatgactccaagaccaagaac
aatgacatagcgctgatgaagctgcatacgcctctgactttcaacgagttagtgaaacca
gtatgtctgcccaacccaggcatgatgctggagccggaacagcactgctggatttctggg
tggggggccacccaggagaaagggaagacctcagacgtgctgaatgctgccatggtgcct
ctcattgagccgtggagatgcaacagcaaatatgtctatgacagcctgatcacaccagcc
atgatctgtgccggcttcctgcaggggaccgttgattcttgccagggtgacagtggaggg
cctctggtcactttgaagaatgatgtctggtggctgatcggggatacaagctggggatct
ggctgtgccaaagcttacagaccaggagtgtacgggaatgtgaccgtattcacggactgg
atttatcgacaaatgagggcagacgactcatcctcatga

DBGET integrated database retrieval system