KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534930
Entry
108534930         CDS       T04641                                 

Gene name
FOS
Definition
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04024  cAMP signaling pathway
rbb04210  Apoptosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04668  TNF signaling pathway
rbb04713  Circadian entrainment
rbb04725  Cholinergic synapse
rbb04728  Dopaminergic synapse
rbb04915  Estrogen signaling pathway
rbb04917  Prolactin signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04932  Non-alcoholic fatty liver disease
rbb04935  Growth hormone synthesis, secretion and action
rbb05031  Amphetamine addiction
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05161  Hepatitis B
rbb05162  Measles
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05224  Breast cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05323  Rheumatoid arthritis
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108534930 (FOS)
   04668 TNF signaling pathway
    108534930 (FOS)
   04024 cAMP signaling pathway
    108534930 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108534930 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108534930 (FOS)
   04660 T cell receptor signaling pathway
    108534930 (FOS)
   04658 Th1 and Th2 cell differentiation
    108534930 (FOS)
   04659 Th17 cell differentiation
    108534930 (FOS)
   04657 IL-17 signaling pathway
    108534930 (FOS)
   04662 B cell receptor signaling pathway
    108534930 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108534930 (FOS)
   04917 Prolactin signaling pathway
    108534930 (FOS)
   04921 Oxytocin signaling pathway
    108534930 (FOS)
   04926 Relaxin signaling pathway
    108534930 (FOS)
   04935 Growth hormone synthesis, secretion and action
    108534930 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    108534930 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    108534930 (FOS)
   04728 Dopaminergic synapse
    108534930 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108534930 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108534930 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108534930 (FOS)
   05231 Choline metabolism in cancer
    108534930 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108534930 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108534930 (FOS)
   05224 Breast cancer
    108534930 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108534930 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    108534930 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108534930 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108534930 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108534930 (FOS)
   05135 Yersinia infection
    108534930 (FOS)
   05133 Pertussis
    108534930 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108534930 (FOS)
   05170 Human immunodeficiency virus 1 infection
    108534930 (FOS)
   05161 Hepatitis B
    108534930 (FOS)
   05171 Coronavirus disease - COVID-19
    108534930 (FOS)
   05162 Measles
    108534930 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108534930 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108534930 (FOS)
   05142 Chagas disease
    108534930 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108534930 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108534930 (FOS)
   04131 Membrane trafficking [BR:rbb04131]
    108534930 (FOS)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    108534930 (FOS)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    108534930 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin HALZ DUF3450
Other DBs
NCBI-GeneID: 108534930
NCBI-ProteinID: XP_017736024
UniProt: A0A2K6LMU6
LinkDB
Position
Un
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGIVKTMTGSRA
QSTGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcgcgctgcagcagcgcg
tccccggccggggatagcctctcctactaccactcacccgccgattccttctccagcatg
ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggcttgtgcagcccgcc
ctcgtctcctctgtggccccatcgcagaccagagcccctcaccccttcggagtccccact
ccctccgctggggcttactccagggctggcattgtgaagaccatgacaggaagccgagca
cagagcactggaaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagaattcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggctgccaccccggagtctgaggaggccttcacc
ctgcctctcctcaatgacccggagcccaagccctcagtggagcctgtcaagagcatcagc
agcatggagctgaaggccgagccctttgatgacttcctgttcccagcatcatccaggccc
agcggctctgagacagcccgctccgtgccagacatggacctatctgggtccttctatgca
gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctatcctgaggctgactccttccccagctgcgcagctgcccaccgcaag
ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system