KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535116
Entry
108535116         CDS       T04641                                 

Gene name
IL10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04061  Viral protein interaction with cytokine and cytokine receptor
rbb04068  FoxO signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04630  JAK-STAT signaling pathway
rbb04660  T cell receptor signaling pathway
rbb04672  Intestinal immune network for IgA production
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05321  Inflammatory bowel disease
rbb05322  Systemic lupus erythematosus
rbb05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108535116 (IL10)
   04068 FoxO signaling pathway
    108535116 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108535116 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108535116 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108535116 (IL10)
   04660 T cell receptor signaling pathway
    108535116 (IL10)
   04672 Intestinal immune network for IgA production
    108535116 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108535116 (IL10)
   05322 Systemic lupus erythematosus
    108535116 (IL10)
   05320 Autoimmune thyroid disease
    108535116 (IL10)
   05321 Inflammatory bowel disease
    108535116 (IL10)
   05330 Allograft rejection
    108535116 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108535116 (IL10)
   05133 Pertussis
    108535116 (IL10)
   05150 Staphylococcus aureus infection
    108535116 (IL10)
   05152 Tuberculosis
    108535116 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108535116 (IL10)
   05144 Malaria
    108535116 (IL10)
   05145 Toxoplasmosis
    108535116 (IL10)
   05140 Leishmaniasis
    108535116 (IL10)
   05142 Chagas disease
    108535116 (IL10)
   05143 African trypanosomiasis
    108535116 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108535116 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108535116 (IL10)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108535116 (IL10)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Cytokines
   108535116 (IL10)
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 108535116
NCBI-ProteinID: XP_017736324
UniProt: A0A2K6MZD3
LinkDB
Position
Un
AA seq 178 aa
MHSSALLCCLVLLTGVRASPGQGTHSENSCTRFPGNVPHMLRDLRDAFSRVKTFFQMKDQ
LDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKMQN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca
ggccagggcacccattctgagaacagctgcacccgcttcccaggcaacgtgcctcacatg
cttcgagacctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag
ctggacaacatattattaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
cacgacccagacatcaaggagcatgtgaactccctgggggagaatctgaagaccctcagg
ctgaggctgcggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggctgtggag
caggtgaagaatgcctttagtaagctccaagagaaaggcgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatgcaaaactga

DBGET integrated database retrieval system