KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535559
Entry
108535559         CDS       T04641                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb04140  Autophagy - animal
rbb04144  Endocytosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108535559 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108535559 (TRAF6)
   04064 NF-kappa B signaling pathway
    108535559 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108535559 (TRAF6)
   04140 Autophagy - animal
    108535559 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108535559 (TRAF6)
   04621 NOD-like receptor signaling pathway
    108535559 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    108535559 (TRAF6)
   04657 IL-17 signaling pathway
    108535559 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108535559 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108535559 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535559 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108535559 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108535559 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108535559 (TRAF6)
   05135 Yersinia infection
    108535559 (TRAF6)
   05133 Pertussis
    108535559 (TRAF6)
   05152 Tuberculosis
    108535559 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108535559 (TRAF6)
   05161 Hepatitis B
    108535559 (TRAF6)
   05160 Hepatitis C
    108535559 (TRAF6)
   05171 Coronavirus disease - COVID-19
    108535559 (TRAF6)
   05162 Measles
    108535559 (TRAF6)
   05168 Herpes simplex virus 1 infection
    108535559 (TRAF6)
   05169 Epstein-Barr virus infection
    108535559 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108535559 (TRAF6)
   05140 Leishmaniasis
    108535559 (TRAF6)
   05142 Chagas disease
    108535559 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108535559 (TRAF6)
   04121 Ubiquitin system [BR:rbb04121]
    108535559 (TRAF6)
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108535559 (TRAF6)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    108535559 (TRAF6)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    108535559 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX Spc29 zf-RING_11 U-box Tropomyosin_1 DUF16 PspA_IM30 EzrA AAA_13 ADIP FliJ UPF0242 DM DUF3450 TMF_DNA_bd CENP-F_leu_zip Filament Spc7 DUF1664 DivIC
Other DBs
NCBI-GeneID: 108535559
NCBI-ProteinID: XP_017737118
UniProt: A0A2K6MKD5
LinkDB
Position
Un
AA seq 522 aa
MSLLNCENSCGSSQSESDCCVAMASSCSAATKDDSVSGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPHEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASVAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPDLLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSGV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgcaacaaaagatgatagtgtgagtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagaattt
gacccacccctagaaagcaagtacgaatgccccatctgcttgatggcactacgagaagca
gtgcaaacaccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcgaaacgtgagattctttctctgatggtgaagtgtccacatgaaggttgtttg
cataagatggaactgaggcatcttgaggatcatcaagcacattgtgagtttgctcttgtg
gattgtccgcagtgccaacgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcagtggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagctccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagagaaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agccttatacccgactctgggtatgtctcagaggtccggaatttccaggaaactatccac
cagttagagggtcgccttgtaagacaagaccatcagatccgggagctgactgctaaaatg
gaaactcagagtacgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaattgaagcacagcagtgcaatggaatttacatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctgggttc
tacacaggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacgatgcaaggagagtatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtccgaagca
cctgtaaggcaaaaccatgaagagataatggatgccaaaccagacctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaactttcatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgcttcgacatgggtagccttcggagggagggttttcagccacgaagtactgattca
ggggtatag

DBGET integrated database retrieval system