KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535710
Entry
108535710         CDS       T04641                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2 member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04911  Insulin secretion
rbb04919  Thyroid hormone signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04922  Glucagon signaling pathway
rbb04931  Insulin resistance
rbb04976  Bile secretion
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
rbb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108535710 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108535710 (SLC2A1)
   04922 Glucagon signaling pathway
    108535710 (SLC2A1)
   04920 Adipocytokine signaling pathway
    108535710 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    108535710 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    108535710 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535710 (SLC2A1)
   05230 Central carbon metabolism in cancer
    108535710 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108535710 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108535710 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108535710 (SLC2A1)
Transporters [BR:rbb02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   108535710 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    108535710 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523 TRI12
Other DBs
NCBI-GeneID: 108535710
NCBI-ProteinID: XP_017737447
UniProt: A0A2K6L9U2
LinkDB
Position
Un
AA seq 492 aa
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIHRYGERILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNEDLWPLLLSIIFVPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggagcccagcagcaagaagctgacgggtcgcctcatgctggccgtgggaggagcagtg
cttggctccctgcagtttggctacaacactggagtcatcaatgccccccagaaggtgatt
gaggagttctacaaccagacatggatccaccgctatggggagcgcatcctgcccaccacg
ctcaccacactctggtccctctcggtggccatcttctccgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaattcaatgctgatgatgaac
ctgctggcctttgtgtctgccgtgctcatgggtttctcgaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtgggtgaggtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcattgtcgttggcatcctcatcgcccaggtgtttggcctggactccatcatg
ggcaacgaggacctgtggcccctgctgctgagcatcatcttcgtcccggccctgctgcag
tgcatcgtgctgcccttctgccccgagagcccccgcttcctgctcatcaaccgcaatgag
gagaaccgggccaagagtgtactgaagaagctgcgcgggacggctgacgtgacccatgac
ctgcaggagatgaaggaagagagtcggcagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcccctgcctaccgccagcccatcctcattgctgtggtgctgcagctg
tcccagcagctgtcgggcatcaatgctgtcttctattactccacgagcatctttgagaag
gcaggggtgcagcagcctgtgtacgccaccattggctccggcattgtcaacacggccttc
actgttgtgtcgctgtttgtggtggagcgagcaggccggcggaccctccacctcataggc
ctggctggcatggcaggttgtgccatactcatgaccatcgcgctggcactgctggagcaa
ctaccctggatgtcctatctgagcatcgtagccatctttggctttgtggccttctttgaa
gtgggtcctggccccattccatggttcatcgtggctgaactcttcagccagggtccacgt
ccagctgccattgctgttgcaggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctacgtcttcatcatcttcactgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcccgagactaaaggccggaccttt
gatgagattgcttccggcttccggcaggggggagccagccaaagtgacaagacacccgag
gagctgttccatcccctgggggctgattcccaagtgtga

DBGET integrated database retrieval system