KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108537349Help
Entry
108537349         CDS       T04641                                 

Gene name
CASKIN2
Definition
(RefSeq) CASK interacting protein 2
  KO
K21952  CASK-interacting protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108537349 (CASKIN2)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    108537349 (CASKIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 SAM_1 Ank_4 Ank Ank_3 Caskin-Pro-rich SAM_2 Caskin-tail SH3_2 Caskin1-CID SH3_1 SH3_9
Motif
Other DBs
NCBI-GeneID: 108537349
NCBI-ProteinID: XP_017740148
LinkDB All DBs
Position
Un
AA seq 1201 aa AA seqDB search
MGREQDLILAVKNGDVTGVQKLVAKVKATKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAP
APLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHGPGLLIENAQPLPSAGEDQVLPGLHPPSLADNLSHHPLTNCRSGEQIFTQDV
RPEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRK
KIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQE
IGVNKLGHQKKLMLGVKRLAELRRGLLQGEALSEGGRRLAKGPELMAIEGLENGEGPATT
GPRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEPPAPQPS
GGDPSNPQERNLPEGTERPPKLCSSLPGQGPHPMFYVPQGSPSSPAPGPPAGAPWAFSYL
AGXPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSALGSYATLTRRPGRSALVRT
SPSVTPTPARGTPRSQSFALRARRKGPPPPPPKRLSSVSGPSPEPPPLDGSPGPKEGATG
PRRRTLSEPAGPSEPTGPPAPAGPASDTEEEEPSPEGMPPSRGSSGEGLPFAEEGNLTIK
QRPKPAGPPPRETPVPPGLDFNLTESDTVKRRPKCREREPLQTALLAFGVASATPDSAAP
LPSPTPGESPLASSPPQPEPSSLPAQGVPTPLAPSPAMQPPVPLCPGTGLESSAASRWNG
ETELPAAPAALLKVPGAGTAPKPVSVACTQLAFSGPKLASRLGPRPVPPPRPESTGTVGP
GKAQQRLEQTSSSLAAALRAAEKSIGTEEQEGAPSASTKHILDDISTMFDALADQLDAML
D
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgaacaggacctgattcttgctgtcaagaatggagatgtgaccggtgtgcag
aaactggtggcaaaggtcaaggccacaaagacaaagctcctgggctccacaaagaggctc
aacgtgaactaccaggacgctgacggattctctgccctccaccatgctgctttggggggc
agcctggagctcatagccttgctgctagaggctcaggccactgttgacatcaaggacagc
aatggcatgcgcccgctgcactacgcagcctggcagggccggctggagcctgtgaggctg
ctgctgcgcgcctctgcggccgtcaatgccgcctcgctggacggacagatcccccttcac
ctggccgcgcagtatggacactatgaggtgtcagaaatgctcctccaacatcagtccaac
ccatgcctggtcaacaaggccaagaagacacccctggacctggcctgtgaatttggccga
ctcaaggtggcccagctactactgaacagccacttatgtgtggcactgctggagggcgag
gccaaggacccttgtgaccccaactatacgacgcccctgcacttggctgccaagaatggc
cacagggaagtcatcaggcagctcctgagagctgggatcgagatcaaccgccagaccaag
acgggtacggcgctccacgaggccgcactgtatggcaagaccgaggtggtgcggctgctc
ctggagggaggtgtggacgtgaacatccggaatacgtataaccagacggcactggacata
gtgaatcagttcaccacctcccaggccagccgggaaatcaagcagctactgcgggaggcc
tcagggatcctgaaggtccgagcactcaaggatttctggaacctccatgatcccactgct
ctcaatgtccgggcaggggatgtcatcacggtgctggaacagcatcccgacggccgctgg
aagggccacatccacgagagccagaggggcacagaccgcataggctacttccccccaggc
attgtcgaggtggtcagcaagcgggtgggcatccctgcagcccgcctcccctccgcaccc
gcccccctgcgcccaggcttctcccgaacaccacagcctcctgccgaagaacccccgcac
cctcttacctacagccagctccctcgggtgggcctcagcccagacagcccagcaggtgac
aggaatagcgtgggcagcgagggcagcgtgggcagcatccgcagtgccggcagcgggcag
agctctgagggcactaacggccacggccctggcctcctgattgagaacgcccagccactg
ccctcagccggagaggaccaggtgctgccaggactccacccaccgtccctggcagacaac
ctgagccaccaccctctgaccaactgccgctctggggagcagatcttcacccaggacgtg
cggccagagcagctgctggaggggaaggacgcgcaggccattcataactggctaagcgag
ttccagctggagggctacactgcccactttctgcaggccggctatgatgtgcccaccatc
agccgcatgacacctgaggacctgacggccatcggggtcaccaagcctgggcacaggaag
aagatcgcctccgagatcgctcagctcagcatcgccgagtggctgcccagctacatccca
accgacctgctggagtggctgtgtgcactggggctgccgcagtaccacaagcagctggtg
agcagtggctacgactccatggggctggtggccgaccttacctgggaggagctgcaggag
attggggtcaacaagctcgggcatcagaagaagctcatgctgggggtgaagcgactggca
gagcttcggcggggcctgctgcagggggaggccctcagtgaaggcgggcgccggctggcc
aagggtccggagctgatggccatcgaggggctggagaacggggaaggcccagctacgact
ggcccacggctcctcaccttccagggcagcgaactaagcccagagctacaagcggccatg
gcaggggggggccctgaaccactccccctcccacctgcccgctctcccagccaggagagc
atcggggcgcgctcgcgggggtctggccactcacaggaaccgcctgccccacagcccagc
ggcggagatcccagcaacccccaggagaggaaccttccagagggcacagagcggccccct
aagctttgttcctcacttcctggccaaggaccccaccctatgttttatgtaccccagggc
tcaccctccagcccggccccagggccacctgctggtgcaccctgggccttctcctatttg
gccgggncccctgccactcccccagacccgcctcgacctaaacgccggtcccacagccta
agccgccctggccccacggagggggatgctgaaggggaggctgaagggccggtgggtagc
gccctaggcagttatgctacccttacccggcggccaggacgcagcgcccttgtccggacc
agtcctagcgtgaccccaactccagctcgggggactcctcgcagccagtccttcgccctg
cgggcccggcgcaaaggccccccgcccccaccccccaagcgcctcagctccgtctctggc
cccagcccggagccacctccactagatgggagcccagggcccaaggaaggggccacgggg
ccccgaaggcgaacactgagtgaacccgctggcccctcagagcccactggcccacctgcc
ccggctgggcctgcatcagacacagaggaggaggagccaagccccgaggggatgccccca
tctcggggcagctccggggaagggctgccgtttgcagaggaagggaacctgaccatcaaa
cagcgcccgaagcccgctggccccccgccccgagagacacccgtgccccctggccttgat
ttcaacctcacggaatcagacactgttaagcggaggcccaagtgccgcgagagagagccg
ctgcagaccgcactgctggccttcggagtggccagtgccacacctgactctgctgccccc
ctgccttccccaactcctggcgagtctcctttagcttctagccctccccagcccgagccc
agcagccttccagcccaaggagttccaaccccccttgctcccagccccgccatgcagcct
ccggtgccactctgcccagggacaggtctggaaagctcagctgctagtcggtggaatggg
gagacagaactcccggctgcccctgccgccctcctcaaggtgcccggagcaggaacagcc
cccaagcctgtgtcggtggcctgcacccagctggcattttctggccctaagctagcgtcc
cggctcggcccccgcccggtgcctcctccacggcctgagagcactgggactgtgggccca
ggcaaggcccagcagagactagagcagaccagctcgtccctggcagctgcactgagagcc
gcagagaagagcattggcacagaggagcaagagggtgcccccagcgcctccaccaagcac
attctggatgacatcagcaccatgttcgatgccctggctgaccagctggacgccatgctg
gactga

DBGET integrated database retrieval system