KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108537828
Entry
108537828         CDS       T04641                                 

Gene name
EGLN1
Definition
(RefSeq) egl-9 family hypoxia inducible factor 1
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108537828 (EGLN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108537828 (EGLN1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108537828 (EGLN1)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     108537828 (EGLN1)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 108537828
NCBI-ProteinID: XP_017741059
LinkDB
Position
Un
AA seq 440 aa
MAVSAAAPPPPWPMTRRARRASPSEPRPGSIASCGATAENPARCSRCRQLFFTGCKEQPS
PSRNWKKHKLVCPGPRRAAPRPNGPAPSTRPPRGGWAGRAGARSLGRARRGAPGTTPPGD
AAKAKAKAKPAADPAAAAVAVSRGPGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPS
NTPGDALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEV
RALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGK
LGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIF
PEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTG
EKGVRVELNKPSDSVGKDVF
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggccgtctcggccgccgcgccgccgccgccatggccaatgacacggcgggcccggcgg
gcgagcccgagcgagccgagacccggcagtattgcgagctgtggggcaacagctgagaac
cctgcgcgctgcagccgctgccggcagctcttttttaccggctgcaaggagcagccaagc
ccgtccaggaactggaagaagcacaagctcgtgtgcccagggccacggagggccgcccct
cggcccaatgggcccgcacccagcactcggcccccgcgcggcggctgggcgggcagggcc
ggggcccggagcctaggaagggcgcggcggggggcgcccgggacaacgcctcccggggac
gcggccaaggcaaaagcaaaggccaagcccgcggccgaccccgccgcggccgccgtcgcc
gtctcgcgcggccccggcggccagggctcggcggtggccgccgaggccgagcccgggaag
gaggagccgccggcccgctcatcgctgttccaggagaaggcgaacctgtaccccccgagc
aacacgcccggggatgcgctgagccccagcggcggcctgcggcccaacgggcagacgaag
cccttgccggcgctgaagctggcgctcgagtacatcgtgccgtgcatgaacaagcacggc
atctgtgtggtggacgacttcctcggcaaggagaccggacagcagatcggcgacgaggtg
cgcgccctgcacgacaccgggaagttcacggacgggcagctggtcagccagaagagcgac
tcgtccaaggacatccgaggcgataagatcacctggatcgagggcaaggagcccggctgc
gaaaccattgggctgctcatgagcagcatggacgacctgatccgccactgtaacgggaag
ctgggcagctacaaaatcaatggccggacgaaagccatggttgcttgttatccgggcaat
ggaacgggttatgtacgtcatgttgataatccaaatggagatggaagatgtgtgacatgt
atatattatcttaataaagactgggatgccaaggtaagtggaggtatacttcgaattttt
ccagaaggcaaagcccagtttgctgacattgaacccaaatttgatagactgctgtttttc
tggtctgaccgtcgcaaccctcatgaagtacaaccagcatatgctacaaggtacgcaata
actgtttggtattttgatgcagatgagagagcacgagctaaagtaaaatatctaacaggt
gaaaaaggtgtgagggttgaactcaataaaccttcagattcagtcggtaaagacgtcttc
tag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539035
Entry
108539035         CDS       T04641                                 

Gene name
EGLN2
Definition
(RefSeq) egl-9 family hypoxia inducible factor 2
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108539035 (EGLN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108539035 (EGLN2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108539035 (EGLN2)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     108539035 (EGLN2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 108539035
NCBI-ProteinID: XP_017742911
UniProt: A0A2K6KEX6
LinkDB
Position
Un
AA seq 405 aa
MDSPCQPQPLSQALPQLPGSSSEPLEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSG
TPRATATSTTASPLRDGFGGQDGGELWPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWA
EDGGDAPSPSKRPWARQENQEAEREGGMSCGCSSGSGEASAGLMEEALPSAPERLALDYI
VPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAW
VEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPH
GDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKP
AYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggacagcccgtgccagccgcagcccctaagtcaggctctccctcagttaccagggtct
tcgtcagagcccttggagcctggccgggccaggatgggggtggagagttacctgccctgt
cccctgcttccctcctaccactgtccaggagtgcctagtgaggcctcggcggggagtggg
actcccagagctacagccacctctaccactgccagcccccttcgggacggttttggcggg
caggatggtggtgagctgtggccgctgcagagtgaaggcgctgcagcgttggtcaccaag
gggtgccagcgactggcagcccagggcgcccggcctgaggcccccaaacggaaatgggcc
gaggatggtggggatgccccttcacccagcaagcggccctgggccaggcaagagaaccag
gaggcagagcgggagggtggcatgagctgcggctgcagcagtggcagtggtgaggccagt
gctgggctgatggaggaggcgctgccctctgcacctgagcgcctggccctggactatatc
gtgccctgcatgcggtactatggcatctgcgtcaaggacagcttcctgggggcagcactg
ggcggccgcgtgctggctgaggtggaggccctcaaacggggtgggcgcctgcgagacggg
cagctagtgagccagcgggcgatcccgccgcgcagcatccgtggggaccagattgcctgg
gtggaaggccatgaaccaggctgccgaagcattggtgccctcatggcccacgtggacgcc
gtcatccgccactgcgcagggcggctgggcagctatgtcatcaacgggcgcaccaaggcc
atggtggcgtgttacccaggcaacgggctcgggtatgtaaggcacgttgacaatccccac
ggcgatgggcgctgcatcacctgtatctattacctgaatcagaactgggacgttaaggtg
catggcggcctgctgcagatcttccctgagggccggccggtggtagccaacatcgaacca
ctctttgaccggttgctcattttctggtctgaccggcggaacccccacgaggtgaagcca
gcctatgccaccaggtacgccatcactgtctggtattttgatgccaaggagcgggcagca
gccaaagacaagtatcagctagcatcaggacagaaaggtgtccaagtacctgtatcacag
ccgcctacgcccacctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108544680
Entry
108544680         CDS       T04641                                 

Gene name
EGLN3
Definition
(RefSeq) egl-9 family hypoxia inducible factor 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108544680 (EGLN3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108544680 (EGLN3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108544680 (EGLN3)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     108544680 (EGLN3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4 ProRS-C_1
Other DBs
NCBI-GeneID: 108544680
NCBI-ProteinID: XP_017751390
UniProt: A0A2K6M960
LinkDB
Position
Un
AA seq 239 aa
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGNYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcccctgggacacatcatgaggctggacctggagaaaattgccctggagtacatcgtg
ccctgtctgcacgaggtgggcttctgctacctggacaacttcctgggcgaggtggtgggc
gactgcgtcctggagcgcgtcaagcagctgcactgcaccggggccctgcgggacggccag
ctggcggggccgcgcgccggcgtctccaagcgacacctgcggggcgaccagatcacgtgg
atcgggggcaacgaggagggctgtgaggccatcagcttcctcttgtccctcatcgacagg
ctggtcctctactgcgggagccggctgggcaactactacgtcaaggagaggtctaaggca
atggtggcttgctatccgggaaatggaacaggttatgttcgccatgtggacaaccccaac
ggtgatggtcgctgcatcacctgcatctactatctgaacaagaattgggatgccaagcta
catggcgggatcctgcggatatttccagaggggaaatcattcatagcagatgtggagccc
atttttgacagactcctgttcttctggtcagatcgcaggaacccacacgaagtgcagcct
tcttacgcaaccagatatgctatgaccgtttggtactttgatgctgaagaaagggcagaa
gccaaaaagaaattcaggaatttaactaggaaaactgaatctgccctcactgaagactga

DBGET integrated database retrieval system