KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538201Help
Entry
108538201         CDS       T04641                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    108538201 (MAPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108538201 (MAPK6)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108538201 (MAPK6)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108538201 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 108538201
NCBI-ProteinID: XP_017741638
LinkDB All DBs
Position
Un
AA seq 724 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFSGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPXFDTSYS
TEPCWQYSDHHENKYCDLECSHTCNYKTRVIIFRXLVWRESEVNHXYESQAYLDLSNWKE
QAKKNLIRKGQTKCEGMDLVKAQIALEEASQQLAXKDKGKESGFDLDSFIAGTIQLSSQQ
SPTDVVDKXNDMNRLKCPTRMKSLISKSVSQKNRKKGNGQIGGGGGSIRTLYQSSWDCQL
VSGGXDLFFINQFCEVRRMEQXENENTYTSYLDKFLAGKKYTEMLETEPIRDGKLGERGH
EAGFLNNSGEFLFNXQLESIGIPQFHSPVGSPLKSIQATLIPSCYEILPSNSHKTYSSIL
KHLN
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggttctaggtat
atggacttaaaaccgttgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgaccatgataacattgtgaaagtg
tttgaaattcttggtcctagtggaagccaattaacagacgatgtgggctctcttacggag
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcatgccaggctgttcatgtatcagctgctacgggggctc
aagtatattcactctgcaaacgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggaccct
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaacccttttctcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgtacatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttaacagcagaagaagcgctctcccatccttacatgagcatctattct
tttccaatggatgagccaatttcaagccatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcacagtcacatttataactgggaaaggtatcatgattgt
cagttttcagagcatgattggcctatacataacaactttgatattgatgaggttcagctt
gatccaagagctctgtccgatgtcactgatgaagaagaagtacaagttgatccccgaaaa
tatttggatggagatcgggaaaagtatctagaggatcctngctttgataccagttactct
actgagccttgttggcaatactcagatcatcatgaaaacaaatattgtgatctggagtgt
agccatacttgtaactacaaaacgagggtcatcatatttagataattagtttggagagag
agtgaagttaaccattaatatgaatcccaagcttatttagatctttccaattggaaagaa
caagccaagaaaaatctgataagaaagggccaaacaaaatgtgaaggaatggatttggtt
aaagcccagatagcgctagaggaagcatcacagcaactggcttgaaaagataagggaaaa
gaatcaggatttgatttggattcctttattgcaggaactattcaacttagttcccaacaa
agccctactgatgttgttgataaatgaaatgacatgaataggctcaagtgtcccactaga
atgaaaagtttgatatcaaagtcagtaagccagaaaaacaggaaaaaaggaaatggccaa
atcgggggggggggtggctcaattagaaccttgtaccaatcttcttgggactgccagttg
gtgagtggtgggnaggacctgtttttcataaatcagttttgtgaggtaaggaggatggaa
caangtgagaacgaaaacacttacactagttacttggacaagttcttagcaggaaagaaa
tatactgaaatgctagaaactgagccaataagagatgggaagcttggggagagaggacat
gaggcaggatttctgaacaacagtggggagttcctctttaactaacagctcgagtccata
ggcatcccgcagtttcacagtccagttgggtcaccacttaagtcaatacaggccacatta
ataccttcctgctatgaaatccttccctcaaattctcataaaacatacagcagcattctg
aaacatctgaactaa

DBGET integrated database retrieval system