KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538696
Entry
108538696         CDS       T04641                                 

Definition
(RefSeq) high affinity immunoglobulin gamma Fc receptor I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04380  Osteoclast differentiation
rbb04640  Hematopoietic cell lineage
rbb04666  Fc gamma R-mediated phagocytosis
rbb05140  Leishmaniasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05202  Transcriptional misregulation in cancer
rbb05221  Acute myeloid leukemia
rbb05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108538696
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108538696
   04666 Fc gamma R-mediated phagocytosis
    108538696
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108538696
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108538696
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    108538696
  09163 Immune disease
   05322 Systemic lupus erythematosus
    108538696
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108538696
   05152 Tuberculosis
    108538696
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108538696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108538696
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rbb04090]
    108538696
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    108538696
CD molecules [BR:rbb04090]
 Proteins
  108538696
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 I-set Adeno_E3_CR1 PIRT Beta_helix
Other DBs
NCBI-GeneID: 108538696
NCBI-ProteinID: XP_017742427
LinkDB
Position
Un
AA seq 358 aa
MWFLTALLLWVPVDGQVVDTTKAVITLQPPWVSVFQEETVTLQCEVPRLPGSNSTQWFLN
GTATQTSTPSYRITSASVKDSGEYRCQRGPSGRSDPIQLEIHRGWLLLQVSGRVFTEGEP
LALRCHAWKDKLVYNVLYYQNGKGFQFFYQNSNLTILKTNISHNGTYHCSGMGKHRYTSA
GVSVTVKELFPAPVLNASVTSPLLEGNPVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGR
NTSSEYQILTARREDSGLYWCEAITEDGNVLKRSPELELQVLGLQLPTPVWLHVLFYLVV
GIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHEKKVTSSLQEDRHLEEELKCQEQE
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtggttcttgacagctctgctcctttgggttccagttgatgggcaagtggtagatacc
acaaaggcagtgatcactttgcagcctccatgggtcagcgtgttccaagaggaaaccgta
accttacagtgtgaggtgccccgtctgcctgggagcaactccacacagtggtttctcaat
ggcacagccactcagacctcgacccccagctacagaatcacctctgccagtgtcaaggac
agtggtgaatacagatgccagagaggtccctcagggcgaagtgaccccatacagctggaa
atccacagaggctggctactactgcaggtctctggcagagtcttcacagaaggagaacct
ctggccttgaggtgtcatgcatggaaggataagctggtgtacaatgtgctttactatcaa
aatggcaaaggctttcagtttttctaccagaattctaacctcaccattctgaaaaccaac
ataagtcacaacggcacctaccactgctcaggcatgggaaagcatcgctacacatcagca
ggagtgtctgtcactgtgaaagagctatttccagctccagtgctgaacgcatctgtgaca
tccccgctcctggaggggaatccggtcaccctgagctgtgaaacaaagttgcttctgcag
aggcctggtttgcagctttacttctccttctacatgggcagcaagaccctgcgaggcagg
aacacatcctctgaataccaaatactaactgctagaagagaagactctgggttatactgg
tgcgaggccatcacagaagacggaaatgtccttaagcgcagccctgagttggagcttcaa
gtgcttgggctccagttaccaactcctgtctggcttcatgtccttttctatctggtagtg
ggaataatgtttttagtgaacactgttctctgggtgacaatacgtaaagaactgaaaaga
aagaaaaagtggaatttagaaatctctttggattctggtcatgagaagaaggtaacttcc
agtcttcaagaagacagacatttagaagaagagctgaagtgtcaggaacaagaataa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542585
Entry
108542585         CDS       T04641                                 

Definition
(RefSeq) low affinity immunoglobulin gamma Fc region receptor III-like
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04380  Osteoclast differentiation
rbb04650  Natural killer cell mediated cytotoxicity
rbb04666  Fc gamma R-mediated phagocytosis
rbb05140  Leishmaniasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108542585
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108542585
   04666 Fc gamma R-mediated phagocytosis
    108542585
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108542585
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    108542585
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108542585
   05152 Tuberculosis
    108542585
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108542585
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108542585
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rbb04090]
    108542585
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rbb00537]
    108542585
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    108542585
CD molecules [BR:rbb04090]
 Proteins
  108542585
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rbb00537]
 Receptors
  108542585
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_6 Ig_5
Other DBs
NCBI-GeneID: 108542585
NCBI-ProteinID: XP_017748151
LinkDB
Position
Un
AA seq 359 aa
MAEGTLRQILHVPSDAQLQTSXGVKGADPPTSPPGSFLPVPVLXWGSLASLQIEKSDEVL
RKGTWWVTEMGGEAGERLFTSSFLVSLVPLGLRISVVTCPLQRGIMWQLLLPTALLLLVS
AGMRAEDLPKAVVFLEPQWYTVLENDSVTLKCQGTYSPEDNSTQWFHNESLISSQTSSYF
IAAARVNNSGEYRCQTRLSTLSDPVQLEVHIGWLLLQAPRQVFKEEDSIHLRCHSWKNTL
LHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLA
VSSISSFFPPGYRVSFCLVMVLLFAVDTGLYFSVKKNIPSSTRDWKDHKFKWSKDPQDK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctgagggcactctccggcagattctgcatgtgccctcagatgctcagctgcagacc
tctngaggagtaaagggggcagacccacccacttcgcctccaggctctttccttcctgtt
cctgttctatgatggggctcccttgccagccttcagattgagaagtcagatgaagttttg
agaaaaggaacctggtgggtgacagagatgggtggagaggctggggaaaggctgtttact
tcctcctttctagtcagcttggtccctttagggctccggatatctgtggtgacttgtcca
ctccagcgtggcatcatgtggcagctgctcctcccaactgctctgctacttctagtttca
gctggcatgcgggctgaagatctcccaaaggctgtggtgttcctggagcctcaatggtac
acggtgctcgagaacgacagtgtgaccctgaagtgccagggaacctactcccctgaggac
aattccacacagtggtttcacaatgagagcctcatctcaagccagacctcgagctacttc
attgctgctgccagagtcaacaacagtggagagtacaggtgccagacaagactctccaca
ctcagtgacccggtgcagctggaagtccatatcggctggctgttgctccaggcccctcgg
caggtgttcaaggaggaagactctattcacctgaggtgtcacagctggaagaacactctt
ctgcataaggtcacatatttacagaatggcaaaggcaggaagtattttcatcagaattct
gacttctacattccaaaagccacacttaaagacagcggctcctacttctgcaggggactt
attgggagtaaaaatgtatcttcagagactgtgaacatcaccatcactcaagatttggca
gtgtcatccatctcatcattctttccacctgggtaccgagtctctttctgcctggtgatg
gtactcctttttgcagtggacacaggactatatttctctgtgaagaaaaacattccaagc
tcaacaagggactggaaggaccataaatttaaatggagcaaagaccctcaagacaaatga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542586
Entry
108542586         CDS       T04641                                 

Gene name
FCGR2A
Definition
(RefSeq) Fc fragment of IgG receptor IIa
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04145  Phagosome
rbb04380  Osteoclast differentiation
rbb04611  Platelet activation
rbb04666  Fc gamma R-mediated phagocytosis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05171  Coronavirus disease - COVID-19
rbb05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108542586 (FCGR2A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108542586 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    108542586 (FCGR2A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108542586 (FCGR2A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    108542586 (FCGR2A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108542586 (FCGR2A)
   05150 Staphylococcus aureus infection
    108542586 (FCGR2A)
   05152 Tuberculosis
    108542586 (FCGR2A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108542586 (FCGR2A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108542586 (FCGR2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108542586 (FCGR2A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rbb04090]
    108542586 (FCGR2A)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    108542586 (FCGR2A)
CD molecules [BR:rbb04090]
 Proteins
  108542586 (FCGR2A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set Ig_5
Other DBs
NCBI-GeneID: 108542586
NCBI-ProteinID: XP_017748152
LinkDB
Position
Un
AA seq 336 aa
MTMETQMSQNVCSSNLWLLQPLTVLLLLASADSQAAAPLKAVLKLEPPWINVLQEDSVTL
TCRGAHSPDSDSTQWFHNGNLIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVL
SEWLALQTPHLEFREGETIMLRCHSWKDKPLIKVTFFQNGISKKFSHVDPNFSIPQANHS
HSGDYHCTGNIGYTPYSSKPVTITVQVPSVGSSSPMGINVAVVTGIAVAAIVAAVVALIY
CRKKQISALPGNPECREMGETLPEKPANSTDPVKAAQFEPPGHQTIAIRKKQLEETNNDY
ETADGGYMTLNPRAPTDDDKNIYLTLPPNNYVNSNN
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgactatggagacccaaatgtctcagaatgtatgttccagcaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaagctgcagctcccctaaag
gctgtgctgaaacttgagcccccgtggatcaatgtgctccaggaggactctgtgactctg
acgtgccggggggctcacagccctgacagcgactccactcagtggttccacaatgggaat
ctcatccctacccacacgcagcccagctacaggttcaaggccaacaacaatgatagcggg
gagtacaggtgccagactggccggaccagcctcagcgaccctgttcatctgactgtgctt
tctgagtggctggcgctccagacccctcacctggagttccgggagggagaaaccatcatg
ctgaggtgccacagctggaaggacaagcctctgatcaaggtcacattcttccagaatgga
atatccaagaaattttcccatgtggatcccaacttctccatcccacaagcaaaccacagt
cacagtggtgattaccactgcacaggaaacataggctacacgccatactcatccaaacct
gtgaccatcactgtccaagtgcccagcgtgggcagctcttcaccgatggggatcaatgtg
gctgtggtcactgggattgctgtagcggccattgttgctgctgtagtggccttgatctac
tgcaggaaaaagcagatttcagctctcccaggaaaccctgagtgcagagaaatgggagag
accctccctgagaaaccagccaattccactgatcctgtgaaggctgcccaatttgagcca
cctggacatcaaacgattgccatcagaaagaaacaacttgaagaaactaacaatgactat
gaaacagctgacgggggctacatgactctgaaccccagggcacctactgatgatgataaa
aacatctacctgactcttcctcccaacaactatgtcaacagtaataactaa

DBGET integrated database retrieval system