KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538745
Entry
108538745         CDS       T04641                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04218  Cellular senescence
rbb04310  Wnt signaling pathway
rbb04340  Hedgehog signaling pathway
rbb04371  Apelin signaling pathway
rbb04390  Hippo signaling pathway
rbb04510  Focal adhesion
rbb04530  Tight junction
rbb04630  JAK-STAT signaling pathway
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04934  Cushing syndrome
rbb05160  Hepatitis C
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05216  Thyroid cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108538745 (CCND1)
   04340 Hedgehog signaling pathway
    108538745 (CCND1)
   04390 Hippo signaling pathway
    108538745 (CCND1)
   04371 Apelin signaling pathway
    108538745 (CCND1)
   04630 JAK-STAT signaling pathway
    108538745 (CCND1)
   04068 FoxO signaling pathway
    108538745 (CCND1)
   04151 PI3K-Akt signaling pathway
    108538745 (CCND1)
   04152 AMPK signaling pathway
    108538745 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108538745 (CCND1)
   04115 p53 signaling pathway
    108538745 (CCND1)
   04218 Cellular senescence
    108538745 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108538745 (CCND1)
   04530 Tight junction
    108538745 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108538745 (CCND1)
   04921 Oxytocin signaling pathway
    108538745 (CCND1)
   04919 Thyroid hormone signaling pathway
    108538745 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538745 (CCND1)
   05206 MicroRNAs in cancer
    108538745 (CCND1)
   05205 Proteoglycans in cancer
    108538745 (CCND1)
   05203 Viral carcinogenesis
    108538745 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108538745 (CCND1)
   05212 Pancreatic cancer
    108538745 (CCND1)
   05225 Hepatocellular carcinoma
    108538745 (CCND1)
   05226 Gastric cancer
    108538745 (CCND1)
   05214 Glioma
    108538745 (CCND1)
   05216 Thyroid cancer
    108538745 (CCND1)
   05221 Acute myeloid leukemia
    108538745 (CCND1)
   05220 Chronic myeloid leukemia
    108538745 (CCND1)
   05218 Melanoma
    108538745 (CCND1)
   05219 Bladder cancer
    108538745 (CCND1)
   05215 Prostate cancer
    108538745 (CCND1)
   05213 Endometrial cancer
    108538745 (CCND1)
   05224 Breast cancer
    108538745 (CCND1)
   05222 Small cell lung cancer
    108538745 (CCND1)
   05223 Non-small cell lung cancer
    108538745 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108538745 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108538745 (CCND1)
   04934 Cushing syndrome
    108538745 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108538745 (CCND1)
   05162 Measles
    108538745 (CCND1)
   05160 Hepatitis C
    108538745 (CCND1)
   05163 Human cytomegalovirus infection
    108538745 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108538745 (CCND1)
   05169 Epstein-Barr virus infection
    108538745 (CCND1)
   05165 Human papillomavirus infection
    108538745 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108538745 (CCND1)
SSDB
Motif
Pfam: Cyclin_C SAM_KSR1
Other DBs
NCBI-GeneID: 108538745
NCBI-ProteinID: XP_017742496
UniProt: A0A2K6LQX9
LinkDB
Position
Un
AA seq 156 aa
MELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNP
PSMVAAGSVVAAVQGLNLGSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSL
RQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 471 nt   +upstreamnt  +downstreamnt
atggagctgctcctggtgaacaagctcaagtggaacctggccgccatgaccccgcatgat
ttcattgaacacttcctttccaaaatgccagaggcggaggagaacaaacagatcatccgc
aaacacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatcca
ccgtccatggtggcagcggggagcgtagtggccgcagtgcaaggcctgaacttggggagc
cccaacaacttcctgtcttactaccgcctcacacgcttcctctccagagtgatcaagtgt
gacccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctg
cgccaggcccagcagaacatggaccccaaggccgctgaggaggaggaagaggaggaggag
gaggtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system