KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538857
Entry
108538857         CDS       T04641                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04062  Chemokine signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04070  Phosphatidylinositol signaling system
rbb04071  Sphingolipid signaling pathway
rbb04150  mTOR signaling pathway
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04370  VEGF signaling pathway
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04613  Neutrophil extracellular trap formation
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04670  Leukocyte transendothelial migration
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04730  Long-term depression
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04931  Insulin resistance
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb04973  Carbohydrate digestion and absorption
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05032  Morphine addiction
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05214  Glioma
rbb05223  Non-small cell lung cancer
rbb05225  Hepatocellular carcinoma
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108538857 (PRKCB)
   04012 ErbB signaling pathway
    108538857 (PRKCB)
   04014 Ras signaling pathway
    108538857 (PRKCB)
   04015 Rap1 signaling pathway
    108538857 (PRKCB)
   04310 Wnt signaling pathway
    108538857 (PRKCB)
   04370 VEGF signaling pathway
    108538857 (PRKCB)
   04064 NF-kappa B signaling pathway
    108538857 (PRKCB)
   04066 HIF-1 signaling pathway
    108538857 (PRKCB)
   04020 Calcium signaling pathway
    108538857 (PRKCB)
   04070 Phosphatidylinositol signaling system
    108538857 (PRKCB)
   04071 Sphingolipid signaling pathway
    108538857 (PRKCB)
   04150 mTOR signaling pathway
    108538857 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108538857 (PRKCB)
   04540 Gap junction
    108538857 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108538857 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    108538857 (PRKCB)
   04662 B cell receptor signaling pathway
    108538857 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    108538857 (PRKCB)
   04670 Leukocyte transendothelial migration
    108538857 (PRKCB)
   04062 Chemokine signaling pathway
    108538857 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    108538857 (PRKCB)
   04929 GnRH secretion
    108538857 (PRKCB)
   04912 GnRH signaling pathway
    108538857 (PRKCB)
   04921 Oxytocin signaling pathway
    108538857 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    108538857 (PRKCB)
   04918 Thyroid hormone synthesis
    108538857 (PRKCB)
   04919 Thyroid hormone signaling pathway
    108538857 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    108538857 (PRKCB)
   04916 Melanogenesis
    108538857 (PRKCB)
   04925 Aldosterone synthesis and secretion
    108538857 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108538857 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    108538857 (PRKCB)
   04971 Gastric acid secretion
    108538857 (PRKCB)
   04972 Pancreatic secretion
    108538857 (PRKCB)
   04973 Carbohydrate digestion and absorption
    108538857 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108538857 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    108538857 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    108538857 (PRKCB)
   04727 GABAergic synapse
    108538857 (PRKCB)
   04725 Cholinergic synapse
    108538857 (PRKCB)
   04728 Dopaminergic synapse
    108538857 (PRKCB)
   04726 Serotonergic synapse
    108538857 (PRKCB)
   04720 Long-term potentiation
    108538857 (PRKCB)
   04730 Long-term depression
    108538857 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    108538857 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108538857 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108538857 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538857 (PRKCB)
   05206 MicroRNAs in cancer
    108538857 (PRKCB)
   05205 Proteoglycans in cancer
    108538857 (PRKCB)
   05231 Choline metabolism in cancer
    108538857 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108538857 (PRKCB)
   05214 Glioma
    108538857 (PRKCB)
   05223 Non-small cell lung cancer
    108538857 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    108538857 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    108538857 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    108538857 (PRKCB)
   05032 Morphine addiction
    108538857 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108538857 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108538857 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108538857 (PRKCB)
   05161 Hepatitis B
    108538857 (PRKCB)
   05171 Coronavirus disease - COVID-19
    108538857 (PRKCB)
   05164 Influenza A
    108538857 (PRKCB)
   05163 Human cytomegalovirus infection
    108538857 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108538857 (PRKCB)
   05140 Leishmaniasis
    108538857 (PRKCB)
   05143 African trypanosomiasis
    108538857 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108538857 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108538857 (PRKCB)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108538857 (PRKCB)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108538857 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Kinase-like CEP76-C2 APH C1_2
Other DBs
NCBI-GeneID: 108538857
NCBI-ProteinID: XP_017742664
LinkDB
Position
Un
AA seq 677 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDMACEMHSHNQCLLNMPSLIGVNHSAKRGHYLLLYLLSLLKQLKIHKT
IRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDK
DRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSE
GNEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGSRDRMKLTDFNFLMVLGKGSFGKV
MLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRL
YFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDS
EGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLA
GQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKE
HAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEF
EGFSFVNSEFLKPEVKS
NT seq 2034 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaatgtgcacgaggtcaagaaccacaaatttacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccctggcgctgacaagggtccagcctctgatgatccccggagc
aaacacaagtttaagatccacacgtactccagtcccacgttttgtgaccactgtgggtca
ttgctgtatggactcatccaccaggggatgaaatgtgacatggcatgtgagatgcacagt
cacaatcagtgcctcctgaatatgccatcattgataggggtaaatcatagtgcaaaaagg
gggcattatctgcttctttatctactctctctcctgaagcaactgaagatccacaaaaca
ataagagatgctaaaaaccttgtacctatggaccccaatggcctgtcagatccctacgta
aaactgaaactgattcctgatcccaaaagtgagagcaaacagaagaccaaaaccatcaaa
tgctccctcaaccctgagtggaacgagacatttagatttcagctgaaagagtcggacaaa
gacagacgactgtcagtagagatttgggattgggatttgaccagcaggaatgacttcatg
ggatctttgtcctttgggatttctgaacttcagaaagccagtgttgatggctggtttaag
ttactgagccaggaggaaggcgagtacttcaatgtgcctgtgccaccagaaggaagtgag
ggcaatgaagaactgcggcagaaatttgagagggccaagatcagtcagggaaccaaggtc
ccagaagaaaagacgaccaatactgtctccaaatttgacaacaatggcagcagagaccgg
atgaaactgactgattttaacttcctaatggtgctggggaaaggcagctttggcaaggtc
atgctttcagaacgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggat
gtcgtgatccaagatgatgacgtggagtgcactatggtggagaagcgggtgctggccctg
cccgggaagccgcccttcctgacccagctccactcctgcttccagaccatggaccgcctg
tactttgtgatggagtatgtcaacgggggcgacctcatgtatcacatccagcaagttggc
cggttcaaggagccccatgctgtattttacgctgcagaaattgccatcggtctgttcttc
ttacagagtaagggcatcatttaccgtgacctaaaacttgacaacgtgatgctcgattct
gaggggcacatcaagattgctgattttggcatgtgtaaggagaacatctgggatggggtg
acaaccaagacattctgtggcactccagactacatcgcccctgagataattgcttatcag
ccctatgggaagtccgtggattggtgggcatttggagtcctgctgtatgaaatgttggct
gggcaggcaccctttgaaggggaagatgaagatgaactcttccagtccatcatggaacac
aacgtagcctatcccaagtctatgtccaaggaagctgtggccatctgcaaaggactgatg
accaaacacccgggcaaacgtttgggttgtggacctgaaggcgaacgtgatatcaaagag
catgcatttttccggtatattgattgggagaaacttgaacgcaaagagatccagccccca
tataagccaaaagcttgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccat
ccaccagtcctaacacctcccgaccaggaagtcatcaggaatattgaccaatcagaattc
gaaggattttcctttgttaactctgaatttttaaaacccgaagtcaagagctaa

DBGET integrated database retrieval system