KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539366
Entry
108539366         CDS       T04641                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04012  ErbB signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04136  Autophagy - other
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04371  Apelin signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04630  JAK-STAT signaling pathway
rbb04659  Th17 cell differentiation
rbb04714  Thermogenesis
rbb04910  Insulin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04920  Adipocytokine signaling pathway
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05221  Acute myeloid leukemia
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108539366 (MTOR)
   04371 Apelin signaling pathway
    108539366 (MTOR)
   04630 JAK-STAT signaling pathway
    108539366 (MTOR)
   04066 HIF-1 signaling pathway
    108539366 (MTOR)
   04072 Phospholipase D signaling pathway
    108539366 (MTOR)
   04151 PI3K-Akt signaling pathway
    108539366 (MTOR)
   04152 AMPK signaling pathway
    108539366 (MTOR)
   04150 mTOR signaling pathway
    108539366 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108539366 (MTOR)
   04136 Autophagy - other
    108539366 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    108539366 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108539366 (MTOR)
   04659 Th17 cell differentiation
    108539366 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108539366 (MTOR)
   04920 Adipocytokine signaling pathway
    108539366 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    108539366 (MTOR)
   04919 Thyroid hormone signaling pathway
    108539366 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    108539366 (MTOR)
   04213 Longevity regulating pathway - multiple species
    108539366 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    108539366 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108539366 (MTOR)
   05206 MicroRNAs in cancer
    108539366 (MTOR)
   05205 Proteoglycans in cancer
    108539366 (MTOR)
   05230 Central carbon metabolism in cancer
    108539366 (MTOR)
   05231 Choline metabolism in cancer
    108539366 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108539366 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108539366 (MTOR)
   05212 Pancreatic cancer
    108539366 (MTOR)
   05225 Hepatocellular carcinoma
    108539366 (MTOR)
   05226 Gastric cancer
    108539366 (MTOR)
   05214 Glioma
    108539366 (MTOR)
   05221 Acute myeloid leukemia
    108539366 (MTOR)
   05215 Prostate cancer
    108539366 (MTOR)
   05224 Breast cancer
    108539366 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108539366 (MTOR)
   05014 Amyotrophic lateral sclerosis
    108539366 (MTOR)
   05016 Huntington disease
    108539366 (MTOR)
   05017 Spinocerebellar ataxia
    108539366 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    108539366 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108539366 (MTOR)
   04931 Insulin resistance
    108539366 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108539366 (MTOR)
   05168 Herpes simplex virus 1 infection
    108539366 (MTOR)
   05163 Human cytomegalovirus infection
    108539366 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108539366 (MTOR)
   05165 Human papillomavirus infection
    108539366 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108539366 (MTOR)
   01522 Endocrine resistance
    108539366 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108539366 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108539366 (MTOR)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108539366 (MTOR)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   108539366 (MTOR)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    108539366 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 108539366
NCBI-ProteinID: XP_017743474
UniProt: A0A2K6K070
LinkDB
Position
Un
AA seq 2527 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNTTTAATTATTATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDKILDGVELGEPAHKKTGTTVPESIHSF
IGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCY
IGWCPFW
NT seq 7584 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagt
gttctacagcagtttgccagtggcctgaagagccggaatgaggagaccagggccaaagcc
gccaaggagctccaacactatgtcaccatggaactccgagagatgagtcaagaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccatcggccgccttgccatggcaggagacactttc
accgctgagtatgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacacgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtggccgcccttcgtgcctgtttgattctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaaggggtttgatgagaccttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgctgatccttaatgagctggtccgaatcagcagcatggagggagag
cgtctgagggaagaaatggaagaaatcacacagcagcagctggtacacgacaagtactgc
aaagatctcatgggcttcggaacaaaacctcgtcacattacccccttcaccagcttccag
gctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttggggcctcccccagcccagctaagtccaccctggtggagagccgg
tgttgcagagacttgatggaggagaaatttgatcaggtatgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatacgcagtacctccaagatactatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctatttgcctcgagtgctggacatcatccga
gcagccctgcctccaaaggacttcgcccataagaggcagaaggcaatgcaggtggacgcc
acagtcttcacttgcatcagcatgctggctcgagcaatggggccaagcatccagcaggat
atcaaggagctgctggagcccatgctggcagtaggactaagtcctgccctcactgcagtg
ctctacgacctgagccgtcagattccacagctaaagaaggacattcaagatgggctactg
aaaatgctgtctctggtccttatgcacaaaccgctccgccacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacaaccctccctgaggccagcgatgtgggc
agcatcactcttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacc
caatttgttcgccactgtgcggatcattttctaaacagtgagcacaaggagatccgcatg
gaggctgcccgcacctgctcccgcctgctcacgccctccatccacctcatcagtggccat
gctcatgtggttagccagactgcagtgcaagtggtggcagatgtgcttagcaagctgctc
gtggttgggataacagatcctgaccctgacattcgctattgtgtcttggcatccctggac
gagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaaccctgcgtttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtgggattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgcgccccgactcatccgtccctacatggagcctattctgaaggcattaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcctggca
acaataggagaattggcacaggttagtggcctggaaatgaggaaatgggttgatgaactt
tttattatcattatggacatgctccaggattcctctttgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtagagccctacaggaag
taccctactttgcttgaggtgctactgaattttctgaagactgagcagaaccagggtaca
cgcagagaggccatccgtgtgttagggcttttaggggctttggatccctacaagcacaaa
gtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactatagcactagtgaaatgctggttaacatgggaaac
ttgcctctggatgagttctacccagctgtgtccatggtggccctgatgcggatcttccga
gaccagtcactctctcaccatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggactcaagtgtgtgcagtttctgccccaggtcatgcccacgttccttaatgtc
attcgagtctgtgatggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacgtcaattcagagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgttgcgt
gtcttcatgcatgacaacagcccaggccgcatcgtctctatcaagttattggctgcaatc
cagctgtttggcgccaacctggatgactacctacatttactgctgcctcctattgtgaag
ttgtttgatgcccctgaagctccactgccatctcgaaaggcagcgctagagactgtggac
cgcctgacggagtccctggatttcactgattatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgctccacagccatggacacgctatcttcactt
gtttttcaactagggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaatcatcagcgctatgatgtgctcatctgcagaattgtcaagggatac
acacttgctgatgaagaggaggatcctttgatttaccagcatcgaatgcttaggagtggc
caaggggatgcattggctagtggaccagtggaaacaggacccatgaagaaactgcacgtc
agcaccatcaatctccaaaaggcctggggtgctgcccggagggtctccaaagatgactgg
ctggaatggctgagacggctgagcctggagctgctgaaggactcatcatcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccaatggccagggatctcttcaatgct
gcatttgtgtcctgctggtctgaattgaatgaagatcaacaggatgagctcatcagaagc
atcgagttggccctcacctcacaagacatcgctgaagtcacacaaaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccactgagagatgacaatggcatt
gttctgctgggtgaaagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcattaat
aataagctacagcagccggaggcagcggccggagtgttagaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgccctg
gtggcctatgacaagaaaatggacaccaacaaggatgacccagagctgatgctgggccgc
atgcgctgccttgaggccctgggggaatggggtcaactccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggacacc
catgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttggca
caacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggcagga
gagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagccctcatgaagacatgagaacctggctcaagtacgcaagcctgtgt
ggcaagagtggcagactggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccgtctcggcaacttgaccatcccctgccgacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagcgcccgcaagatcgatgccttccagcacatgcagcatttt
gtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcataag
caggaactgcacaagctcatggcccgatgcttcctgaaacttggagagtggcagctgaat
ctacagggcatcaacgagagcacaatccccaaagtgctgcagtactacagcgctgccacc
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaacttcgaagct
gtgctacactacaaacatcagaaccaagcccgcgacgagaagaagaaactgcgtcatgcc
agcggggctaacatcaccaacaccaccactgccgccaccacggccactactgccaccacc
actgccagcaccgagggcagcaacagtgagagcgaggccgagagcactgagaacagcccc
accccatcgccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatgtac
acggtgcctgccgtccagggcttcttccgttccatctccttgtcacgaggcaacaacctc
caggatacactcagagttctcaccttatggtttgattatggtcactggccagatgttaat
gaggccttagtggagggggtgaaagccatccagattgatacctggctacaggttatacct
cagctcattgcaagaattgatactcccagacccttggtgggacgtctcattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctaccccctgacagtggcttct
aagtctaccacgacagcccggcacaacgcagccaacaagattctgaagaacatgtgtgag
cacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgagtggcc
atcctgtggcatgagatgtggcacgaaggcctggaagaggcctctcgtttgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacgg
ggcccccagactctgaaggagacatcctttaatcaggcctatggtcgagatttaatggag
gcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcactcaagcc
tgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcagctcacatcc
ttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtctttg
caagtcatcacatccaagcagaggccccggaaattgacacttatgggcagcaacgggcat
gagtttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgtgtgatgcag
ctcttcggcctggttaacacccttctggccaatgacccaacatctcttcggaaaaacctc
agcatccagagatatgccgtcatccctttatcgaccaactcaggcctcattggctgggtg
ccccattgtgacacactgcacgccctcatccgggactacagggagaagaagaagatcctt
ctcaacatcgagcatcgcatcatgttgcggatggctccggactatgaccacttgactctg
atgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggacgacctggcc
aagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaagaaccaattat
acccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagatagacac
ccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggggac
tgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcacatgc
cacacagtgatggaggtgctacgggagcacaaggacagtgtcatggctgtgctggaagcc
tttgtctatgaccccttgctgaactggaggctgatggacaaaattttggacggtgtggaa
cttggggagccagcccataagaaaacggggaccacagtgccagaatcgattcattctttc
attggagacggtttggtgaaaccagaggccctaaataagaaagctattcagattattaac
agggttcgagataagctcactggtcgggacttctctcatgatgacactttggatgttcca
acacaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgccagtgctat
attggctggtgccctttctggtaa

DBGET integrated database retrieval system