KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539726Help
Entry
108539726         CDS       T04641                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00500  Starch and sucrose metabolism
rbb01100  Metabolic pathways
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04910  Insulin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04931  Insulin resistance
Module
rbb_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108539726 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108539726 (GYS2)
   04152 AMPK signaling pathway
    108539726 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108539726 (GYS2)
   04922 Glucagon signaling pathway
    108539726 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    108539726 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rbb01003]
    108539726 (GYS2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     108539726 (GYS2)
Glycosyltransferases [BR:rbb01003]
 Polysaccharide
  Storage polysaccharide
   108539726 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 108539726
NCBI-ProteinID: XP_017744098
UniProt: A0A2K6LAX1
LinkDB All DBs
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPRWEVEELPVEELLLFEVAWEVTNRVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVVAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQG
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVE
DEVEDERYDEEKEAERDRLNIKSPFALSHVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgatccctgtctgtaacatccctgagtgggcttccccggtgggaagtc
gaagaacttcctgtggaggagttactcctctttgaagttgcttgggaggtgaccaataga
gttggaggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatgggga
gacaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatgctgtcagaagagcagtggacgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtactttttgacata
ggctattcagcttggaatctggataggtggaagggtgacctctgggaagcatgcagtgtt
ggcattccttatcatgaccgagaagccaatgatatgctgatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcacgcagatggtaaacatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgagccaggaaacttcctattgccaca
atatttacaacccatgctacactactcgggaggtatctctgtgcagcaaatattgatttc
tacaaccatcttgataagtttaacatagacaaagaagctggagaaaggcagatttaccac
cggtactgcatggagcgagcctccgttcattgcgctcatgttttcaccacggtttctgaa
ataacagcaatagaggccgaacatatgctgaagagaaagcctgatgtggttactccaaat
ggcttgaatgttaagaaattttcagcagtacatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggctaaatttcctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcatcatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacaactgtgggacattgcacattctgtgaaggaaaagttt
gggaaaaaactctatgatgcattattaagaggagaaattcctgacatgaacaatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgattgatgactccaccgaccccatcctcagcaccatt
agacggattggacttttcaacaaccgcacagacagagtcaaggtgattttgcacccagag
tttctatcctccaccagtcccctactacccatggactatgaagagtttgtcagaggttgt
catcttggagtatttccgtcatactatgaaccctggggttatactccagctgaatgcact
gtgatgggtatccccagtgtgaccacgaacctctccgggtttggctgtttcatgcagggg
catgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactcagtttctttatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccagacacctgacattaagcagagcttttccagataaa
ttccatgtggaactaacatcaccaccaacgacagaaggattcaaatatcccaggccttcc
tcagtaccaccttctccttcagggtctcaggcctccagtcctcagagcagtgatgtggaa
gacgaagtggaggatgagagatacgatgaggaaaaggaggctgaaagggatcggttaaat
atcaagtcaccatttgcactgagccacgttcctcatgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system