KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539959
Entry
108539959         CDS       T04641                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00220  Arginine biosynthesis
rbb00330  Arginine and proline metabolism
rbb01100  Metabolic pathways
rbb04020  Calcium signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04146  Peroxisome
rbb04371  Apelin signaling pathway
rbb04926  Relaxin signaling pathway
rbb05010  Alzheimer disease
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05133  Pertussis
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108539959 (NOS2)
   00330 Arginine and proline metabolism
    108539959 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108539959 (NOS2)
   04066 HIF-1 signaling pathway
    108539959 (NOS2)
   04020 Calcium signaling pathway
    108539959 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108539959 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108539959 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108539959 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108539959 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108539959 (NOS2)
   05014 Amyotrophic lateral sclerosis
    108539959 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    108539959 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108539959 (NOS2)
   05152 Tuberculosis
    108539959 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108539959 (NOS2)
   05145 Toxoplasmosis
    108539959 (NOS2)
   05140 Leishmaniasis
    108539959 (NOS2)
   05142 Chagas disease
    108539959 (NOS2)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108539959 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1
Other DBs
NCBI-GeneID: 108539959
NCBI-ProteinID: XP_017744419
LinkDB
Position
Un
AA seq 901 aa
MREGLGAACEAAGPRLCRLLCRILRPKPACCLRGASPVTQDDLQYHSLSKQQNESLQPLV
GTGKKSPESLVKPDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMT
PKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARNCSTAREMFEHICRHVRYSTNNGNIR
SAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYGR
FDVVPLVLQADGHDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVVEINIA
VLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEML
NYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKMMASRVRVTI
LFATETGKSEALAWDLGALFSCAFNPKVVCMDKYSLSCLEEERLLLVVTSTFGNGDCPGN
GEKLKKSLFMLKELTNKFRYAVFGLGSSMYPRFCAFARDIDQKLSHLGASQLTPMGEGDE
LSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSSVTWDPHHYRLVQDSQPLDLS
KALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGICPGNQP
ALVQGILERVVDSPAPHQIVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQL
LLQKLAQVATEVTERQRLEALCQVKIRVGGQCGYVGGLRMWGAGAQSWSLTSKRDPPRFP
K
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgcgcgaggggttgggcgcggcgtgcgaggccgctgggccccggctttgccggctgctt
tgcaggatcctccggccgaagcccgcctgctgcctgcgcggagccagtccagtgacacag
gatgaccttcagtatcacagcctcagcaagcagcagaatgagtccctgcagcccctcgtg
gggacaggaaagaagtctccagaatctctggtcaagccggatgcaaccccattgtcctcc
ccacgacatgtgaggatcaaaaactggggcagcgggatgactttccaggacacacttcac
cacaaggccaaagggattttgacttgcaggtccaaatcttgcttgggatccattatgact
cccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttctacct
caagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagaggaa
catctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaactg
acgggagatgagctcatcttcgctaccaagcaggcctggcgcaatgccccacgctgcatt
gggaggatccagtggtccaacctgcaggtctttgatgcccgcaactgttccaccgcccgg
gaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatcagg
tcggccatcaccgtgttcccccagcggagcgatggtaagcacgacttccgggtgtggaat
gctcagctcatccgctacgcgggctaccagatgccagatggcagcatcagaggggaccct
gccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtatggccgc
ttcgatgtggtccccctggtcctacaggctgacggccatgaccctgagctcttcgaaatc
ccacctgaccttgtgcttgaggtggccatggaacatcccaaatatgagtggtttcgggaa
ctggagctaaagtggtacgccctgcctgcagtggccaacatgctgctcgaggtgggcggc
ctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtccgg
gacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggcttg
gaaacgcacaagctggcctcgctctggaaagaccgggctgttgttgagatcaacattgct
gtgctccatagtttccagaagcaaaacgtgaccatcatggaccaccactcagctgcagaa
tccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagactgg
atttggctggtccctcccatgtctgggagcatcactcccgtgtttcaccaggagatgctg
aactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtctgg
caggacgagaagcggagacccaagagaagagagattccgttgaaagtcttggtcaaagct
gtgctcttcgcctgtatgctgatgcgcaagatgatggcgtcccgagtcagagtcaccatc
ctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttgttc
agctgtgccttcaaccccaaggttgtctgcatggataagtacagcctgagctgcctggag
gaggagcggctgctgttggtggtgaccagtacgtttggcaatggagactgccccggcaac
ggagagaaactgaagaaatcgctcttcatgctgaaagagctcaccaacaaattcaggtat
gctgtgtttggccttggctccagcatgtaccctcggttctgcgcctttgctcgtgacatc
gatcagaagctgtcccacctgggggcctctcagctcacccccatgggagaaggggatgag
ctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcctgt
gagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctccagt
gtgacctgggacccacaccactacaggctcgtgcaggactcacagcctttggacctcagc
aaagccctcagcagcatgcacgccaagaacgtgttcaccatgaggctcaaatctcggcag
aacctacagagtccgacatccagccgtgccaccatcctggtggaactctcctgtgaggac
ggccaaggcctgaactacttgccaggggagcaccttgggatttgcccaggcaaccagccg
gccctggtccaaggcatcctggagcgagtggtggacagccccgcgccccaccagatagtg
cgcctggaggccctggacgagagcggcagctactgggtcagtgacaagaggctgcccccc
tgctcactcagccaggccctcacctacttcctggatatcaccacccccccaacccagctg
ctgctccaaaagctggcccaggtggccacagaagtgactgagagacagaggctggaggcc
ctgtgccaggtgaagatcagggttggtgggcagtgcgggtatgtggggggtctcagaatg
tggggagctggagctcagagctggtctttaacttccaagagggatccacccaggttccca
aagtga

DBGET integrated database retrieval system