KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540302
Entry
108540302         CDS       T04641                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04211  Longevity regulating pathway
rbb04371  Apelin signaling pathway
rbb04380  Osteoclast differentiation
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04921  Oxytocin signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb05031  Amphetamine addiction
rbb05034  Alcoholism
rbb05214  Glioma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108540302 (CAMK4)
   04020 Calcium signaling pathway
    108540302 (CAMK4)
   04024 cAMP signaling pathway
    108540302 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108540302 (CAMK4)
   04925 Aldosterone synthesis and secretion
    108540302 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    108540302 (CAMK4)
   04720 Long-term potentiation
    108540302 (CAMK4)
   04722 Neurotrophin signaling pathway
    108540302 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108540302 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    108540302 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    108540302 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    108540302 (CAMK4)
   05034 Alcoholism
    108540302 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108540302 (CAMK4)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108540302 (CAMK4)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   108540302 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo DUF1103 Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 108540302
NCBI-ProteinID: XP_017744781
LinkDB
Position
Un
AA seq 616 aa
MMRGSLCLPQAPASGAALAGTAAATAWEGERKEGGRRERLGAGGGRVRRKLAGGGGGASL
LCGAAPLPPAGGDSGFPLAPSRRCSPLPRPPSLRARAAAVGVCAREGRRLSLAPAFAGGG
WRPASRSGGGGGGGSGFRSPAAKMLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGS
NRDALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLS
HPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHE
NGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCA
YGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFIXPWWDEVSLNAKDLV
RKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASS
RLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQSDGAQAAVKGAQAELMKV
QALEKVKGSDINAEEAPRMVPKAVEDGIKVADLELEEGLAEEKLKTVEEVAAPREGQGSS
AVGFEVPQQDVILPEY
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgatgcgcgggtccctgtgccttccccaagctccagcatccggagccgccctagccggc
accgcggcagccacagcctgggagggagaaaggaaagagggagggcggcgggaaaggctt
ggcgcgggaggagggcgggtgaggaggaaattagcgggcgggggggggggagcctctctc
ctctgcggtgccgctcctctccctccggcgggcggcgactccgggttccccctagcgccc
tcacgccgctgctcgccccttccccgcccaccgtccctgagagcgcgggcggcggcggtg
ggcgtgtgcgcgcgtgaaggacgccgcctctctctcgctcctgcgttcgcaggcggcggc
tggcggccggcttctcgctcgggcggcggcggcggcggcggcagcggcttccggagtccc
gctgcgaagatgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcttcggtc
accgccagtgcggccccggggaccgcgagcctcgtcccggattactggatcgacggctcc
aacagggatgcgctgagcgatttcttcgaggtggagtcggagctgggacggggtgctaca
tccattgtgtacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgtta
aagaaaacagtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctca
catccaaacattataaaacttaaagagatatttgaaacccctacagaaatcagtctggtc
ctagaactcgtcacaggaggagaactgtttgataggattgtggaaaagggatattacagt
gagcgagatgctgcagatgctgttaaacaaatcctggaggcagtcgcttatctacatgaa
aatggaattgtccatcgtgatctcaaaccagagaatcttctctatgcaactccagcccca
gatgcaccactcaaaatcgctgattttggactctctaaaattgtggaacatcaagtgctc
atgaagacagtatgtggaaccccagggtactgcgcacctgaaattcttagaggttgtgcc
tatggacctgaggtggacatgtggtctgtaggaataatcacctacatcttactttgtgga
tttgaaccattctatgatgaaagaggtgatcagttcatgttcagaagaattctgaattgt
gaatattactttatcntcccctggtgggatgaagtgtctctaaatgccaaggacttggtc
agaaaattaattgttttggatccaaagaaacggctgactacctttcaagctctccagcat
ccgtgggtcacaggtaaagcagccaattttgtacacatggataccgctcaaaagaagctt
caagaattcaatgcccggcgtaaacttaaggcagcggtgaaggctgtggtggcctcttcc
cggctgggaagtgccagcagcagccatggcagcatccaggagagccacaaggctagccga
gacccttctccaatccaagacggcaacgaggacatgaaagctattccagaaggagagaaa
attcaaagcgatggggcccaagccgcagttaagggggcacaggctgagctgatgaaggtg
caagccttagagaaagttaaaggttcagatataaatgctgaagaggcccccaggatggtg
cccaaggcagtggaggatgggataaaggtggctgacctggaactagaggagggcctagca
gaggagaagctgaagactgtggaggaagtagcagctcccagggaagggcaaggaagctct
gctgtgggctttgaagttccacagcaagatgtgatcctgccagagtactaa

DBGET integrated database retrieval system