KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540807Help
Entry
108540807         CDS       T04641                                 

Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108540807
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     108540807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 SPARC_Ca_bdg EF-hand_8 RST
Motif
Other DBs
NCBI-GeneID: 108540807
NCBI-ProteinID: XP_017745524
LinkDB All DBs
Position
Un
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFCGFMRTLAHFRPVEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLHKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQGGDSAISFTEFVKVS
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
accggcttttcccacagtcaaatcactcgcctctacagccggttcaccagcctggacaaa
ggagagaacgggactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttctttccagagggagaggaccaggtaaacttc
tgtggattcatgcgaactttggctcatttccgccccgttgaggataatgaaaagagcaaa
gatgtgaatggacccgaacctctcaacagccgaagcaacaaactgcactttgcttttcga
ctgtatgatttgcataaagatgaaaagatctcccgtgatgagctgttacaggtgctacgc
atgatggtcggagtaaatatctcagatgagcagctgggcagcatcgcagacaggaccatt
caggaggctgatcagggtggggacagtgccatatctttcacagaatttgttaaggtttcg
gagaaggtggatgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system