KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540867
Entry
108540867         CDS       T04641                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00860  Porphyrin and chlorophyll metabolism
rbb01100  Metabolic pathways
rbb04066  HIF-1 signaling pathway
rbb04216  Ferroptosis
rbb04978  Mineral absorption
rbb05200  Pathways in cancer
rbb05206  MicroRNAs in cancer
rbb05225  Hepatocellular carcinoma
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    108540867 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108540867 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    108540867 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    108540867 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108540867 (HMOX1)
   05206 MicroRNAs in cancer
    108540867 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108540867 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108540867 (HMOX1)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     108540867 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase REC1
Other DBs
NCBI-GeneID: 108540867
NCBI-ProteinID: XP_017745618
UniProt: A0A2K6KWP3
LinkDB
Position
Un
AA seq 284 aa
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTREGFKLVMASLHHIYVA
LEEEIERNKENPVFTPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQMLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDTRAPHRHPGLRPA
GQPTKGKTLPPWRLPKGSPRSTPAPRLRFSDGSLRSAFWWRQLP
NT seq 855 nt   +upstreamnt  +downstreamnt
atggagcgtccgcaacccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacactcaggcagagaatgctgagttcatgaggaactttcagaagggc
caggtgacccgagagggcttcaagctggtgatggcctccctgcaccacatctatgtggcc
ctggaggaggagattgagcgcaacaaggagaacccagtcttcacccctgtctacttccca
gaagagctgcaccgcaaggccgccctggagcaggacctggccttctggtacgggccccgc
tggcaggaagtcatcccgtacacaccagcaatgcagcgctacgtgaagcggctccacgag
gtggggcgcacagagcctgagctgctggtggcccatgcctacacccgctacctgggtgac
ctgtctgggggccagatgctcaagaagattgctcagaaagccctggacctgcccagctct
ggcgagggcctggccttcttcaccttccccaacattgccagtgccaccaagttcaagcag
ctctaccgctcccgcatgaactccctggagatgactcccgcggtcaggcagagggtgata
gaagaggccaagaccgcgttcctgctcaacatccagctctttgaggagttgcaggagctg
ctgacacatgacaccaaggacacgagagcccctcacaggcacccagggcttcgcccagcg
ggccagccaacaaagggcaagactctgcccccgtggagactcccaaagggaagcccccgc
tcaacgcccgctcccaggctccgcttctccgatgggtccttacgctcagctttctggtgg
cgacagttgccgtag

DBGET integrated database retrieval system