KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541026
Entry
108541026         CDS       T04641                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04630  JAK-STAT signaling pathway
rbb04810  Regulation of actin cytoskeleton
rbb05160  Hepatitis C
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05226  Gastric cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108541026 (EGF)
   04012 ErbB signaling pathway
    108541026 (EGF)
   04014 Ras signaling pathway
    108541026 (EGF)
   04015 Rap1 signaling pathway
    108541026 (EGF)
   04630 JAK-STAT signaling pathway
    108541026 (EGF)
   04066 HIF-1 signaling pathway
    108541026 (EGF)
   04068 FoxO signaling pathway
    108541026 (EGF)
   04020 Calcium signaling pathway
    108541026 (EGF)
   04072 Phospholipase D signaling pathway
    108541026 (EGF)
   04151 PI3K-Akt signaling pathway
    108541026 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108541026 (EGF)
   04540 Gap junction
    108541026 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108541026 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108541026 (EGF)
   05231 Choline metabolism in cancer
    108541026 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108541026 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108541026 (EGF)
   05212 Pancreatic cancer
    108541026 (EGF)
   05226 Gastric cancer
    108541026 (EGF)
   05214 Glioma
    108541026 (EGF)
   05218 Melanoma
    108541026 (EGF)
   05219 Bladder cancer
    108541026 (EGF)
   05215 Prostate cancer
    108541026 (EGF)
   05213 Endometrial cancer
    108541026 (EGF)
   05224 Breast cancer
    108541026 (EGF)
   05223 Non-small cell lung cancer
    108541026 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108541026 (EGF)
   05165 Human papillomavirus infection
    108541026 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108541026 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108541026 (EGF)
Cytokines and growth factors [BR:rbb04052]
 Growth factors
  Growth factors (RTK binding)
   108541026 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF EGF_CA EGF_3 DUF5050
Other DBs
NCBI-GeneID: 108541026
NCBI-ProteinID: XP_017745917
LinkDB
Position
Un
AA seq 1216 aa
MLLTLIILLPVVLKFSFVSLSAPQHWSCPEGTPAGHGNSTRVGPAPFLIFSHGNSIFRID
TEGTNYEPLVVDAGVSVIMDFHYKEKIIYWVDLERQLLQRVFLNGSRRERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHVLLSALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVEVKSLLETSEKITAVSLDVLDKRLFWIQYSREGSNSLICSCDYDGGSVRI
SKHPTQHNLFAMSLFGDHVFYSTWKTRTIWIANKHTGKDMVRINLHPSFVPPGELKVVHP
LAQPKAEDDAREREQKLHKSRKGNCSSTVCGQDAQSHLCTCAEGYTLSRDRKYCEGNDRK
YCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDC
VLTSEDPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQLCISLSPVSWECDCFPGYDLQLD
KKSCVASGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTA
LKWIERANMDGSQRERLIEEGVDMPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKHPKII
IKENISQPRGIAVHPTAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPNGITIDFL
TDKLYWCDAKQSVIEIANLDGSKRRRLTQNDVGHPFAIAVFEDYVWFSDWAMPSVIRVNK
KTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKERLGIAWCFCREGFM
KASDGKTCLALDGHQLLAGGEVDLKNQVTPLDTLSKTRVSEDNITESQHMLVAEIMVSDQ
YDCAPVGCSTYARCVSEGDDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTE
GGYVCQCSEGYQGDGIHCLDIDECQLGVHSCGENANCTNTEGGYTCTCAGRLSEPGLICP
DSTPPPHLREDDHHYSVRNSDSGCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERC
QYRDLKWWELRHAGHGQQQKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKLLTKNPKNPSE
ESSRDARSRRPDDSEDGMSSCPQPWFVVTKEHQDLRNGSQPVAGEDGQAADVGSVQPTSW
RQEPQLRGVGPEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQPLDGGVQKPHSFLSVNPL
WQQRALDPPHQMELTQ
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagttttaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactcccgcaggacatgggaattctact
cgtgtgggtcctgcacccttcttaattttctcccacggaaatagtatctttaggattgac
acggaaggaaccaattatgagccattggtggtggatgctggtgtctcagtgatcatggat
tttcattataaagagaaaataatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcgagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacgttcttttaagtgctttaaaatatcct
gcaaatatagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctggc
agcctttacagagcagatcttgatggtgtggaagtgaagtctctgttagagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacagc
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccgtatt
agtaaacatccaacacagcacaatttgtttgcaatgtccctttttggtgaccatgtcttc
tattcaacatggaaaacgaggacaatttggatagccaacaaacacactggaaaggatatg
gttagaattaacctccatccatcatttgtaccacctggtgaactgaaagtagtgcatcca
cttgcacagcccaaggcagaagatgatgctcgggagcgtgagcagaaacttcacaaatcg
aggaagggaaactgcagcagcactgtgtgtgggcaagacgcccagtcacacttgtgcacg
tgtgcagagggatacaccttaagtcgagaccggaagtactgtgaaggtaatgaccggaag
tactgtgaagatgttaatgaatgtgctttttggaatcatggctgtactcttgggtgtaaa
aacacccctggatcctattactgcacatgccctgtaggatttgttctgcttcctgatggg
aaacgatgtcatcaacttgtttcctgtccaagcaatgtgtctgaatgcagccatgactgt
gttctgacatcagaagatcccttatgtttctgtcctgaaggctcagtgcttgagagagat
gggaaaacatgtagcggttgttcctcacctgataatggtggatgtagccagctctgcatt
tctctcagcccagtatcctgggaatgtgattgctttcctgggtatgacctacaactggat
aaaaaaagctgtgtagcttcaggaccacaaccatttttgctgtttgccaattctcaagat
attcgacacatgcattttgatggaacagactatggaactctgctcagccagcagatggga
atggtttatgccctagatcatgaccctgtggaaaataagatatactttgcccatacagcc
ctgaagtggatagagagagctaatatggatggttcccagcgagaaaggcttattgaggaa
ggagtagatatgccagaaggtcttgctgtggactggattggccgtagattctattggaca
gacagagggaaatctctgattggaaggagtgatttaaatggaaaacatcccaaaataatc
attaaggagaacatctctcaaccacgaggaattgctgttcatccaacggccaagagatta
ttctggacggatacagggattaatccacgaattgaaagttcttccctccaaggccttggc
cgactggttatagccagctctgatctaatctggcccaatggaataacgattgacttctta
actgacaagttgtattggtgcgatgccaagcagtctgtaattgaaatagccaatctggat
ggttcaaaacgccgaagacttacccagaacgatgtaggtcacccatttgctatagctgtg
tttgaggattatgtgtggttctcagattgggctatgccttcagtaataagagtaaacaag
aagactggcaaagatagagtacgtctccaaggcagcatgctgaagccctcctcactggtt
gtggttcatccactggcaaaaccaggagcagatccctgcttatatcaaaacggaggctgt
gaacatatttgcaaagagaggcttggaattgcttggtgtttttgtcgtgaaggttttatg
aaagcctcagatgggaaaacgtgtctggctctggatggtcatcagctgttggcaggtggt
gaagttgatctaaagaaccaggtaacaccattggacaccttatcgaagactagagtgtca
gaagataacattacagaatctcaacacatgctagtggctgaaatcatggtgtcagatcaa
tatgactgtgctcctgtgggatgcagcacatatgctcggtgtgtttcagagggagacgat
gccacgtgtcagtgtttgaaaggatttgctggggatggaaaactatgttctgatatagat
gaatgtgagatgggtgtcccagtgtgcccccctgcctcctccaagtgcatcaacaccgaa
ggtggctatgtctgccagtgctcagaaggctaccaaggagatgggattcactgtcttgat
attgatgagtgccaactgggggtgcacagctgtggagagaatgccaactgcacaaataca
gagggtggctacacctgcacatgtgctggacgcctgtctgaaccaggactgatttgccct
gactctactccaccccctcacctcagggaagatgaccaccactattctgtaagaaatagt
gactctggatgtcccctgtcccacgatggatactgcctccatgatggtgtgtgcatgtat
attgaagcattggacaaatatgcatgcaactgtgttgttggctacatcggggagcgatgt
cagtaccgagacctgaagtggtgggaactgcgtcacgctggccacgggcagcagcagaag
gtcaccgtggtggctgtctgcgtggtggtgcttgtcgtgctgctcctcctgagcctgtgg
ggtgcccactactacaggactcagaagctgctaacgaaaaatccaaagaatccttctgag
gagtcaagcagagacgcgaggagtcgcaggcctgatgacagtgaggatgggatgtcctct
tgccctcaaccttggtttgtggttacaaaggaacaccaagacctcaggaatgggagtcaa
ccagtggctggtgaggatggccaggcagcagatgttgggtcagtgcaaccaacttcatgg
aggcaggagccccagttacgtggagtgggcccagagcaaggctgctggattccagtatcc
agtgataagggctcctgtccccaggtaatggagcgaagctttcatatgccctcctatggg
acacagccccttgatgggggtgtccagaagccccattctttcctatcagttaacccatta
tggcaacaaagggccctggacccaccacaccaaatggagctgactcagtga

DBGET integrated database retrieval system