KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541550Help
Entry
108541550         CDS       T04641                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00052  Galactose metabolism
rbb00500  Starch and sucrose metabolism
rbb01100  Metabolic pathways
rbb04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108541550 (MGAM)
   00500 Starch and sucrose metabolism
    108541550 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108541550 (MGAM)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     108541550 (MGAM)
    3.2.1.20  alpha-glucosidase
     108541550 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108541550
NCBI-ProteinID: XP_017746564
LinkDB All DBs
Position
Un
AA seq 1849 aa AA seqDB search
MARKKLKKFTTLEIVLSVLLLVLFIISTVLIVLLAKESLKSTAPDPGTTDPPDPGTTGST
QPRTTGPLDPGTTGTTPISAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVP
WCYYSKNHSYHMEGDLVNTNAGFTAQLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLT
DQTNNRFEVPHEHVQSFSGNAAASLTYQVEISREPFSIKVTRRSNNRVLFDSSIGPLLFA
DQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLC
LEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIG
RPALPSYWALGFHLSRYQYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDPV
NFKGFPEFVSDLHKNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLI
GEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN
LNNPPFTPRVLDGYLFCKTLCMDAVQHWGKQYDVHNLYGYTMAVATAEAAKTVFPNKRSF
ILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDAPEE
LCRRWMQLGAFYPFSRNHNGQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFF
RAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVIAYVPDAVWYD
YETGNQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENK
EAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTE
EPSNVTVKHNGVPRQASPTVTYDSNLKVAIITDIDLLLGEAYTVEWDIKIRDDEKIDCYP
DENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSIYAN
AFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPRVPSSTPEGQLYDVLIK
KNPFGIEIRRKSTGSIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLEW
HTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTT
GGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVA
AQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPY
PAFTRGLEDDIFIKYPNDGDIVWGKVWPDFPGVVVNESLDWDSQVELYRAYVAFPDFFRN
STAKWWKREIEELYNNPQNPERSLKFDGLWIDMNEPASFVNGAVSPGCRDASLNHPPYMP
HLESRDWGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVTGQRGVVI
SRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMC
VRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMHKAHT
EGVTVVRPLLHEFVSDQLTWDIDSQFLLGPAFLVSPVLELNARDVTAYFPRARWYDYYTG
VDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAEG
WLFWDDGQSIDTYGKGLYYLANFSASQNTMQSHIIFNNYITDTNPLKLGYIEIWGVGSVP
ITSVSISVSGMAITPSFNNYPTTQVLSIDVTDRNISVHNFTSLTWRSTP
NT seq 5550 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
ctcgtgttgtttatcatcagtactgttctaattgtgcttttagccaaagagtcattgaaa
tcaacagccccagatcccgggacaactgatcccccagatcctggaacaactggttccaca
cagcctaggacaacgggtcccctagatcctggaacaactggtaccactcctatttctgct
gaatgtccagtggtaaatgaattggaacgaattaattgcatccctgaccagccaccaaca
aaggccacatgtgaccaacgtggctgttgctggaatccccagggagctgtgagtgttccc
tggtgctactattccaagaatcatagctaccacatggagggcgaccttgtaaacacaaat
gcaggattcacagcccagttgaaaaatctgccttcttcacccgtgttcggaagcaatgtt
gacaatgttcttctcacagcagaatatcagacatctaatcgtttccactttaagttgacc
gaccaaaccaataacaggtttgaagtaccccatgaacatgtgcagtcctttagtggaaat
gctgctgcttctttgacctaccaagttgaaatctccagagagccatttagcatcaaagtg
accagaagaagcaacaatcgtgttttgtttgactcaagcattgggcccctcctgtttgcc
gaccagttcttgcagctctccacccgactgcctagtgctaatgtgtatggcctgggagag
catgtgcaccagcagtaccggcatgatatgaattggaagacctggcccatatttaacagg
gacacaactcccaatggaaatggaactaatttgtatggtgcgcagacattcttcctgtgt
cttgaagatgctagtggattgtcctttggggtgtttctgatgaacagcaatgccatggag
gttgtccttcagcctgcgccagccatcacttaccgcaccattgggggcattctcgacttc
tatgtgttcttgggaaacactccagagcaagttgttcaagaatatctagagcttattggg
cggccagcccttccctcctattgggcacttggatttcatctcagtcgttatcaatatgga
accttagacaacatgagagaagtcgtggagagaaatcgcgcagcacagctcccttatgat
gttcagcatgctgatattgattatatggatgagagaagggacttcacttatgatccagtg
aattttaaaggcttccctgaatttgtcagtgacttacacaaaaatggacagaagcttgtc
atcattgtggatccagccatctccaacaactcttcctcaagtaaaccctatggcccatat
gacaggggttcagatatgaagatatgggtgaatagttcagatggagtgactccactcatt
ggggaggtctggcctggacaaactgtgtttcctgattataccaatcccaactgtgctgtt
tggtggacaaaggaatttgaactttttcataatcaagtggagtttgatggaatctggatt
gatatgaatgaagtctccaactttgttgatggttcggtctcaggatgttccacaaacaac
ctaaataatcccccattcactcccagagtcctggatgggtacctgttctgcaagactctc
tgtatggatgcagtgcagcactggggcaagcagtacgacgttcacaatctgtatggctac
accatggcggttgccacagcagaagctgccaagactgtgttccctaataagagaagcttc
attctgacccgttctacctttgcgggctctggcaagtttgcagcacattggttaggagac
aacaccgccacctgggatgacttgcgatggtccatccctggcgtgcttgagttcaacctt
tttggcatcccaatggtgggtcctgacatatgtggttttgccttggatgcccctgaggag
ctctgtaggcggtggatgcagttgggtgcattttatccattttctagaaatcacaatggc
caaggcttcaaggaccaggatcctgcctcctttggagctgactccctgctgttgaattcc
tccaggcactaccttaacatccgctatactctattgccctacctatacaccctcttcttc
cgtgctcacagccgaggggacacggtggctaggccccttttgcatgagttctacgaggac
aacagcacttgggatgtgcaccaacagttcttatgggggcccggcctcctcatcactcca
gttctggatgaaggtgcagagaaagtgatagcatatgtgcctgatgctgtctggtatgac
tacgagactgggaaccaagtgagatggaggaagcaaaaagtcgagatggaacttcctgga
gacaaaattggacttcaccttcgaggaggctacatctttcccacacagcagccaaataca
accactctggccagtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaa
gaagcaaaaggagaacttttctgggatgatggggaaacgaaggatactgtggccaataaa
gtgtatcttttatgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaa
tcaacctacaaggaccccaataatttagcatttaatgagattaaaattcttgggacggag
gaacctagtaatgttacagtgaaacacaatggtgtgccacgtcaggcttctcctacagtc
acttatgattctaacctgaaggttgccattatcacagatattgatcttctcctgggagaa
gcatacacagtggagtgggatataaagataagggatgatgaaaaaatagactgttaccct
gatgagaatggtgcttctgcagaaaactgcactgcccgtggctgtatctgggaggcatcc
aattcttctggagtccctttttgctattttgtcaacgatctatactctgtcagtaatgtt
caatataattcacatggggccacagctgacatctccttaaagtcttccatttatgccaat
gccttcccctccacacccgtgaacccccttcgcctggatgtcacttaccataagaatgaa
atgctgcagttcaagatttatgatcccaacaacaatcggtatgaagttccagttcctctg
aacgtacccagggtgccatccagcacccctgagggtcaactctatgatgtcctcattaag
aagaatccatttgggattgaaattcgccgcaagagtacaggcagtataatttgggactct
cagctccttggtttcaccttcaatgacatgtttatccgcatctccacccgccttccctcc
aagtacctctatggctttggggaaactgagcacacatcctataggagagacttggagtgg
cacacttgggggatgttctcccgagaccagcccccagggtacaagaagaattcctatggt
gtccacccctactacatggggctggaggaggatggcagtgcccacggagtgttcctgctg
aacagcaatgccatggacgtgacgttccagcccctgcctgccttgacataccgtaccaca
gggggagttctggacttttatgtgttcttggggccaactccagagcttgtcacccagcaa
tacactgagttgattggccgacctgtgatggtaccttactggtctttaggtttccagctg
tgtcgctatggataccagaatgactctgagatcgccagcttgtatgatgagatggtggcc
gcgcagatcccttatgatgtgcagtactcagacatcgactacatggagcggcagctggac
ttcaccctcagccccaagtttgctgggtttccagctctgatcaatcgcatgaaggctgat
gggatgcgggtcatcctcattctggatccagccatttctggcaatgagacacagccctat
cctgccttcactcggggcttggaggatgacatcttcatcaaatacccaaatgatggagac
attgtctggggaaaggtctggcccgattttcctggtgttgttgtgaatgaatctctagac
tgggacagccaagtggagctatatcgagcttacgtggccttcccagactttttccgtaat
tcaactgccaagtggtggaagagggaaatagaagaactgtacaacaatccacagaatccg
gagaggagcttgaagtttgatggcctgtggattgatatgaatgaaccagcaagcttcgtg
aatggggcagtttctccaggctgcagggacgcctctctgaaccaccctccctacatgcca
catttggagtccagggactggggcctgagcagcaagaccctgtgcatggagagtcagcag
atcctcccagacggctccccggtgcagcactacaatgtgcacaacctgtacgggtggtcc
cagaccagacccacatacgaagccatgcaggaggtgacgggacagcgaggggtggtcatc
agccgctccacatttccgtcttctggccgctgggcaggacattggctgggagacaacacg
gccgcgtgggatcagctgaagaaatctatcattggcatgatggagttcagcctcttcggc
atatcctatacaggagcagatatctgtgggttctttcaagatgctgaatatgagatgtgt
gttcgctggatgcagctgggggctttttaccccttctcaagaaaccacaacaccattggg
accaggagacaagaccctgtgtcctgggatgctgcttttgtgaacatttccagaaatgtc
ttgcagaccagatacaccctgttgccatatctgtataccttgatgcataaggcccacaca
gagggtgtcactgttgtgcggcccctgcttcatgagtttgtgtcagaccagctgacgtgg
gacatagacagtcagttcctgctgggcccagccttcctggtcagccctgtcctggagctc
aatgccagagatgtcactgcatatttccctagagcccgctggtacgattactacacgggt
gtggatattaatgcaagaggagagtggaagaccttgccagcccctcttgaccacattaat
cttcatgtccgtgggggctacatcctgccctggcaagagcctgcactgaacacccactta
agccgccagaagttcatgggcttcaaaattgccttggatgatgagggaactgctgagggc
tggctcttctgggatgatgggcaaagcattgatacctatgggaaaggactctattacttg
gccaacttttctgccagccagaatacgatgcaaagccatataattttcaacaattacatc
actgatacaaatcctttgaaactgggctacattgaaatctggggagtgggcagtgtcccc
attaccagtgtcagcatatctgtgagcggcatggccataacaccatccttcaacaattac
cccacgacacaggtattaagcatcgatgtgactgacagaaacatcagtgtacataatttt
acttcattgacatggagaagcactccgtga

DBGET integrated database retrieval system