KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541557Help
Entry
108541557         CDS       T04641                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00052  Galactose metabolism
rbb00500  Starch and sucrose metabolism
rbb01100  Metabolic pathways
rbb04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108541557 (MGAM2)
   00500 Starch and sucrose metabolism
    108541557 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108541557 (MGAM2)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     108541557 (MGAM2)
    3.2.1.20  alpha-glucosidase
     108541557 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108541557
NCBI-ProteinID: XP_017746575
UniProt: A0A2K6KIL2
LinkDB All DBs
Position
Un
AA seq 2516 aa AA seqDB search
MARKLSVLEVLLIIFCLTVVVIDILLLLLVLEELSDTSFTPECPDIPHSERINCIPDQEV
TEDICRWQYKCCWSPVEDASVPRCFFPRNWGYEASNGHTSTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENIRLVDGTADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTKGMINLYGAHTFFLCLEDTSGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQQYLELVGRPFLPPYWSLGFQLSRRDYGGINELKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHENGQKYVIIMNPGISKNSNYEPYN
NGSLKRVWILGNNGFAVGEGYPGPAVFPDYTNPVCTEWWIDQVAKFHDHLEFDGVWIEMN
EVSSLLQASNDQCESNDLNFPPFLPRVLDHLLFARTLCMDTEFYGGLHYDIHSLYGHSMA
RTTNLALETVFMNNRSFILSRSTFAGSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYTNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGADSLLLSSSRH
YLNIRYTLLPYLYTLFYRAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYVFPTQKPNTTTE
ASRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
TDTDNLMFTEITILGMDKQPANFTILLNNVATSSPSVVYNASTKVVTITDLQGLVLGQEF
SIRWNLPVSDPEKFNCYPDNPTASEESCRQRGCLWEDTSTPGVPTCYYDTIPNYAASDIQ
YLSTSITANLSLLMASESAAAAAASDSVSAQISLLRLNVIYHTATMLQVKIYDPTNKRYE
VPVPLNTPPQPVGDPENCLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFTFNDMFLSIS
TRLPSQYIYGFGETEHTTFRRNMNWNTWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAH
GVLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWA
LGFQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSLLIE
QMKKNGMRFILTLDPAISGNETQYLPFIRGQENNVFIKWPDTSDIVWGKVWPDLPDVTVD
GSLDHATQVKLYKAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEP
SNFVNGSVRGCSDEMLNNPPYMPYLESRDRGLNSKTLCMESQQILPDGSPVKHYNVHSLY
GWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMEFS
LFGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLS
RKVLKTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDHQFMLGPAILISPV
LETSTFEISAYFPRARWYDYSTGTSSKSTGQRKILKAPLDHINLHVRGGYILPWQEPAMN
THSSRQNFMGLTVALDDNGKAEGQVFWDDGQSIDTYENGNYFLANFIAAQNILQIQTIHN
KYLSDSNPLKVGYIRIWGVNSTYVTQVNFTYDNWQFMETNFMSDPYNQTLTIQLTDKSIN
LEKLTEVTWIDGDPVLPTPTKTSTIPMSSPPSPSTTNATSSETITSSASANTTTGTTATI
PITTTSFPTSTIGVTTNATVPNTTAPFPTNATASANATVPIPTTPLATNTIGVTTNATVP
DTTVPFPTNIATASTNRTVPITTTPFATSTTGVTTSTTVPDTTAPFPTSTTTASTNATVP
ITTTPFPTSTIGVTTNATVPDTTVPFPTNITTASTNATVPITTTPFATSTIGVTTSTTVP
DTTAPFLTSTTGASTRASVPFTTTPFPTNTADANTNNTVPNTTMPSPTGSTTVSTIATIP
ISVTPSLTSTADATISTTVLIATTPSLTITTDVSTSTTINDISTPFQTNTTNASTSTNVA
NITATSHTRTDDTVPNNTVPITAIPSLANTGVDTTSNSFSIMTTSFSESSNAMDTAVIMV
TTSPTSADVASTNNDASVTNSLLAKMSAGNTTSNSISITTTSFGNSVPIVTTPSPSPDAT
TTSSNTIPGMTTYYQTSPTTPTHTLTSIPSSITPILSMFPTSHTFTTDKITNFTTPTNAN
TIIFNTLDTKSTMIIDAMVTITSTRDNTISPDTTVTSTDKFTTHITQFTTPHSTTTTTLA
LSHTSLAPTNLSNIGTMDITDADNSSSVTGNTTHISVSNITTASDTITATGLDSQTPHMV
TNSVASYLPITATSATKDTTSITKYALNTATPDSTVHTSATSPTYITNAINATQVP
NT seq 7551 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaagctcagtgtattggaagtccttctgatcatcttctgcctaactgtggtg
gtcatagatatcctcttgctgcttcttgtgttggaggaactttcagatacttcatttact
ccagagtgcccagatattccccactcggaaaggataaactgcatacctgaccaggaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcacctgtggaggatgccagt
gtccctaggtgcttcttcccccgtaactggggctatgaagccagcaatggccatacaagt
acaagcacaggattcaccgcccagttgaaaaggttgccatccccatctctgtttggaaat
gatgtcgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaacattaggctggttgat
gggactgctgatgcctccaatttgagctattacgtggaagttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcttgttggacacgagcatcgggcccctc
cagtttgcccagcagtacctgcaactgtctttccgactgcccagtgccaatgtgtatggg
ctgggagaacatgtgcaccagcagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgggatgccacccccaccaagggcatgattaatctgtatggagctcatacattc
ttcttgtgccttgaagacaccagtggctcctcttttggagtttttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcaatcacttatcgcacgattggaggcatt
cttgacttttatgtattcctaggaaacactccagaacaagtggttcagcaatacttggag
cttgttggacggccattcttgcctccctattggagtcttgggttccagcttagtcgcagg
gattatggtggcatcaatgaattgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgacgtccaatactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggaattacatgaaaatggacag
aaatatgttattattatgaatcctggcatctccaaaaactctaactacgagccctataat
aatggaagcctaaagagagtgtggatcttggggaacaatggttttgctgttggggaggga
tatccaggaccggcagtctttcccgattacaccaatccagtatgcactgagtggtggata
gatcaggttgctaaatttcatgatcatctggagtttgatggagtgtggattgaaatgaat
gaagtttctagcttactccaagcttctaatgaccagtgtgaatccaacgacttgaacttt
cctccttttcttcctagagttctggatcacttactttttgcaagaactctctgcatggac
acggagttttatggaggccttcactatgacatccacagcttgtatggccactccatggca
agaaccacaaacttagccctggagaccgtcttcatgaataacaggagcttcatcttatcc
cgttcaacttttgctggatctggccaatttgctgctcattggctgggggacaatgcggcc
acatgggatgacctccgatggtctattcccactatccttgagttcaacctgtttggcatc
cccatggtaggtgccaacatctgtggttacaccaacaatgtcacggaggagctctgcaga
aggtggatgcaacttggagcattttatccactaccaaggaatcacaatgggcctgggttc
agggaccaggatcctgctgcctttggtgctgattccctgctgctgagttcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccgtgctcac
acccggggagagacggtagcaaggccccttgtacatgagttctaccaggactcagccaca
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacgccggtcttatat
gaaggtgtggacgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggctatcccatggaggaagcagttggtgaatatgcttctcccaggtgataagata
ggacttcatctgcgagggggctacgtatttcccactcaaaagccgaacacaaccacagaa
gccagccggaggaattccctgggactcatcattgccttggactataagagagaagcaaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtaactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacaagcaaagattataaataataattat
acggacactgacaacctcatgtttacagaaatcacaatcttgggaatggacaaacagcca
gctaattttactatcttactgaataatgtcgccacctccagtccaagcgttgtctacaat
gcttccacaaaggtggtaaccatcactgatctccaaggactggtactgggacaagaattc
tctattaggtggaatcttcctgtcagtgacccggagaagttcaactgctaccctgacaat
ccaacagcctctgaggagagttgtcggcagcgggggtgtctttgggaggatacatctact
cctggagtgcccacctgttactatgacaccatccctaattatgctgctagtgacattcag
tacctgagcactagcattactgcaaacctttccctcctgatggcctctgagtcagctgct
gctgctgctgcctctgattctgtctctgcacagatcagcctcctccgcctcaacgtgatc
tatcacacagcaaccatgctgcaggtcaagatctatgaccccactaataaaaggtacgag
gttccagtaccactgaacactcctccccaaccagttggtgaccctgaaaactgtctgtat
gatgtcaggattcagaacaatccttttggaatccagatccaacgcaaaaactccagcact
gtgatttgggattctcaactccctggcttcaccttcaatgacatgtttctctccatttct
acgcgtctgccctctcagtacatctatggttttggggaaactgagcacacgactttcaga
cgaaacatgaactggaacacatggggaatgtttgctcgcgatgagccacctgcgtacaag
aagaattcctatggtgtccacccttactacatggcactggaggaggatggtagtgcccat
ggagtgctcctgctaaatagcaatgctatggatgtgacgttacagcccactcctgccctg
acataccgcaccactggagggattttggacttctacattgttttggggccaacccctgaa
cttgtaactcagcaatacaccgagttgatcggtcggccagcaatgattccatactgggcc
ttgggattccagctaagtcgctatggataccagaatgatgctgaaatctccagtttgtat
gatgcaatggtggcagcccagattccctatgatgtccagcatgtagacatcgattacatg
aaccggaagctggatttcaccctcagtgccaactttcaaaacctcagtcttctgattgag
caaatgaagaaaaatggcatgagatttattctcactttggacccagccatttctggcaat
gagacacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaatggcct
gacaccagtgacattgtctggggaaaggtttggccagatctgcctgatgtaactgtagat
ggatcccttgaccatgcaactcaggttaagctttacaaggcctacgttgcctttcctgac
ttctttcgtaatagcacagctgcatggtggaagaaagagatagaagagctctatgcaaat
cctcgagagccagagaagagcctgaagtttgatggattgtggattgatatgaatgagcca
tcaaactttgtgaatggatctgtcaggggctgcagcgatgaaatgctaaataacccaccc
tatatgccatatttggaatctagggacaggggcctgaacagcaagaccctgtgcatggag
agtcagcagatcctgccagacggctcccccgtgaagcactacaacgtgcacagcctgtac
gggtggtcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgaggg
atcgtcatcacccgctccacatttccctcttctggacgctggggaggacactggctggga
gacaatacagctgcgtgggaccagctggggaaatctatcattggcatgatggagttcagt
ctctttggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatat
gagatgtgtgttcgctggatgcaactgggggcattttatccattttccagaaaccacaac
aacattgggacaaggagacaagatcctgtggcctggaattcaacctttgagatgttgtcc
agaaaagtcctaaagaccagatacaccctgcttccttatctctatactctgatgcataaa
gctcatgttgagggcagcactgttgttcgaccccttctccatgagtttacggatgacagg
acaacatgggatatagaccatcagttcatgttgggtcctgctatcttaatcagccctgtg
ttggaaactagcacatttgagatctctgcttattttccgagagcccgttggtatgactat
agcacgggaactagcagcaaatcgacaggtcagaggaaaatcctgaaggctccccttgac
cacatcaaccttcatgtcagaggaggctacatcctgccctggcaagagcctgcaatgaac
actcactccagtcgacagaattttatgggattgactgttgctttggatgacaatgggaaa
gctgaaggccaggtgttctgggatgatggacaaagcattgatacctatgaaaatggaaat
tattttttggcaaactttatagcagctcagaacatcctgcaaatccagaccatacacaat
aagtatttgagtgactcgaatccactgaaagttggatatattagaatctggggtgtgaac
tctacttatgtgacacaagtcaatttcacctatgacaactggcaatttatggagacaaat
ttcatgagtgacccttataatcagacactaactattcaattgactgacaagagtatcaac
ctggaaaagttaactgaggttacttggattgatggtgatcctgtacttcccactccaact
aagacaagcaccatcccaatgagttctcctccttctccatctactaccaatgccaccagt
tctgagacaatcaccagttctgccagtgcaaatactaccactggcactactgctactatt
cccatcacaaccacatctttcccaacaagtactattggtgttacaactaatgctactgtt
cccaatacaactgcccctttcccaacaaatgctactgctagcgctaatgctacagttcct
atcccaaccacacctttggcaacaaatactattggtgttacaactaatgctactgttccc
gatacaactgtccctttcccaacaaatattgctactgctagcactaatcgtactgttcct
atcacaaccacaccttttgcaacaagtactactggtgttacaactagtactactgttcct
gatacaactgctcctttccctacaagtactactactgctagcactaatgctactgttcct
atcacaaccacaccttttccaacaagtactattggtgttacaactaatgctactgttccc
gatacaactgtccctttcccgacaaatattactactgctagcactaatgctactgttcct
atcacaaccacaccttttgcaacaagtactattggtgttacaactagtactactgttcct
gatacaactgctcctttccttacaagtactactggtgctagcactagggctagtgttcct
tttacaaccacacctttccctacaaatactgctgatgctaacactaataatactgttcct
aataccactatgccttctcctacaggtagtactactgtgagtactattgctaccattccc
atttcagtgactccttctctgacaagtactgctgatgccaccattagtactactgtactt
attgccactactccttctctaacaattactactgatgttagcactagtactactattaat
gatataagtactccttttcaaacaaatactactaatgctagcactagtactaatgttgct
aatataactgctacctctcatacaaggactgatgatactgttcctaataatactgttcca
attacagctattccttctcttgcaaatactggtgttgacactactagcaacagtttttct
attatgaccacttctttctctgaaagtagtaatgctatggatactgctgttattatggta
accacttctcctacaagtgctgatgttgctagcacaaataatgatgcttctgtgacaaat
tctcttttagctaaaatgtctgctggtaatacaactagtaatagtatttccataacaact
acttcttttggtaatagtgttcctattgtgactactccttctccaagtcctgatgctact
actacaagtagtaatactattcctggcatgactacttattaccaaacttctcctaccact
cctacccatactcttacttctattcctagctctattactcctattttgagcatgtttcca
acaagtcatacattcactactgataaaattactaattttactacccctacaaatgcaaac
accataattttcaacactcttgatacaaaaagtaccatgataatagatgctatggtcact
attaccagcaccagagataataccataagtccggatacaacagttacttccacagacaaa
ttcaccacacacatcacacagttcactactccccattctactactactacaacactggcc
ttaagccacacatcattagctcctacaaatctttctaatataggcaccatggatattact
gatgcagataactccagcagtgttacaggtaacactacacacatttctgtttcaaatatc
acaacagcttcagacacaataacagctactggtctagattcacaaactccccacatggta
acaaattctgtggctagttatttacctattactgcaactagtgctaccaaagatactaca
agtattacaaaatatgctttaaatactgccactcctgatagtacagtacatacctctgct
acttcacctacttatattaccaatgccataaatgctactcaagttccatga

DBGET integrated database retrieval system