KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541711
Entry
108541711         CDS       T04641                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04071  Sphingolipid signaling pathway
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04217  Necroptosis
rbb04650  Natural killer cell mediated cytotoxicity
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05014  Amyotrophic lateral sclerosis
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    108541711 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108541711 (BID)
   04215 Apoptosis - multiple species
    108541711 (BID)
   04217 Necroptosis
    108541711 (BID)
   04115 p53 signaling pathway
    108541711 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108541711 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108541711 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108541711 (BID)
   05014 Amyotrophic lateral sclerosis
    108541711 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    108541711 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108541711 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108541711 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108541711 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108541711 (BID)
   05161 Hepatitis B
    108541711 (BID)
   05160 Hepatitis C
    108541711 (BID)
   05164 Influenza A
    108541711 (BID)
   05162 Measles
    108541711 (BID)
   05168 Herpes simplex virus 1 infection
    108541711 (BID)
   05163 Human cytomegalovirus infection
    108541711 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108541711 (BID)
   05169 Epstein-Barr virus infection
    108541711 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108541711 (BID)
SSDB
Motif
Pfam: BID Bcl-2 Rubis-subs-bind CRM1_C
Other DBs
NCBI-GeneID: 108541711
NCBI-ProteinID: XP_017746813
LinkDB
Position
Un
AA seq 245 aa
MAQVPSYEMHGHTQRGFLLGSPVGEWGTACSGAGPPGLCEPQADCRAAQAMDCQVSNGSG
LRDECITNLLVFGFLQSCSDNSFRRELDVLGRELPVPAPQWEGYDELQTDGNRSSHSRMG
RIEADSESQEDVIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTNQSEEDRNRDLATA
LEQLLQAYPTDMEKEKAMLVLALLLAKKVASHTPSLLRDVFQTTVNFINQNLRAYVRSLA
RNGMD
NT seq 738 nt   +upstreamnt  +downstreamnt
atggctcaggtcccttcctatgaaatgcacggccacacccagcgagggtttctcctgggc
tccccagtgggagagtggggtacagcctgcagcggtgcagggcccccaggcctgtgtgag
cctcaagcggactgccgcgctgcccaggccatggactgtcaggtcagcaatggttccggc
ctcagggatgagtgcatcacaaacctactggtgttcggcttcctccaaagctgctctgac
aatagcttccgcagagagctggacgtgctgggccgcgagctgccagtgccagctccccag
tgggagggctacgacgagcttcagacggatggcaaccgcagcagccactcccgcatggga
agaatagaggcagattctgaaagtcaagaggacgtcatccggaacattgccaggcacctc
gcccaggtcggggacagcatggaccgcagcatccctccgggcctggtgaacggcctggcc
ctgcagctcaggaacaccaaccagtcggaggaggaccggaacagggacctggccactgcc
ctggagcagctgctgcaggcctaccctacagacatggagaaggagaaggccatgctggtg
ctggccctgctgctggccaagaaggtggccagtcacacgccgtccttgctccgtgatgtc
tttcaaacaacggtgaattttattaaccagaacctacgcgcctatgtgaggagcttagcc
agaaacgggatggactga

DBGET integrated database retrieval system