KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541809
Entry
108541809         CDS       T04641                                 

Gene name
IL1B
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01523  Antifolate resistance
rbb04010  MAPK signaling pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04064  NF-kappa B signaling pathway
rbb04217  Necroptosis
rbb04380  Osteoclast differentiation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04640  Hematopoietic cell lineage
rbb04657  IL-17 signaling pathway
rbb04659  Th17 cell differentiation
rbb04668  TNF signaling pathway
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04940  Type I diabetes mellitus
rbb05010  Alzheimer disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05144  Malaria
rbb05146  Amoebiasis
rbb05152  Tuberculosis
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05168  Herpes simplex virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05321  Inflammatory bowel disease
rbb05323  Rheumatoid arthritis
rbb05332  Graft-versus-host disease
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108541809 (IL1B)
   04064 NF-kappa B signaling pathway
    108541809 (IL1B)
   04668 TNF signaling pathway
    108541809 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108541809 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108541809 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108541809 (IL1B)
   04620 Toll-like receptor signaling pathway
    108541809 (IL1B)
   04621 NOD-like receptor signaling pathway
    108541809 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    108541809 (IL1B)
   04625 C-type lectin receptor signaling pathway
    108541809 (IL1B)
   04659 Th17 cell differentiation
    108541809 (IL1B)
   04657 IL-17 signaling pathway
    108541809 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108541809 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108541809 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    108541809 (IL1B)
   05321 Inflammatory bowel disease
    108541809 (IL1B)
   05332 Graft-versus-host disease
    108541809 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108541809 (IL1B)
   05020 Prion disease
    108541809 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    108541809 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108541809 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108541809 (IL1B)
   04932 Non-alcoholic fatty liver disease
    108541809 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108541809 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108541809 (IL1B)
   05135 Yersinia infection
    108541809 (IL1B)
   05133 Pertussis
    108541809 (IL1B)
   05134 Legionellosis
    108541809 (IL1B)
   05152 Tuberculosis
    108541809 (IL1B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108541809 (IL1B)
   05164 Influenza A
    108541809 (IL1B)
   05162 Measles
    108541809 (IL1B)
   05168 Herpes simplex virus 1 infection
    108541809 (IL1B)
   05163 Human cytomegalovirus infection
    108541809 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108541809 (IL1B)
   05144 Malaria
    108541809 (IL1B)
   05140 Leishmaniasis
    108541809 (IL1B)
   05142 Chagas disease
    108541809 (IL1B)
   05143 African trypanosomiasis
    108541809 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108541809 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108541809 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108541809 (IL1B)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108541809 (IL1B)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Cytokines
   108541809 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep Inhibitor_I71
Other DBs
NCBI-GeneID: 108541809
NCBI-ProteinID: XP_017746974
UniProt: A0A2K6L2N5
LinkDB
Position
Un
AA seq 269 aa
MAEVPELASEMMAYYSGNEDDLFFEVDGPKEMKCSFQDLDLCPLDGVIQLRISHEHYSKG
FRQAVSVVVAMEKLRKMLVPCPQTFQDNDLSTLFPFIFEEEPIFLDTCNNDPYVHDAPVR
SLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKA
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKVEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcagaagtacctgaactcgccagtgaaatgatggcttactacagcggcaacgaggat
gacttgttctttgaagtcgatggccctaaagagatgaagtgctccttccaggatctagac
ctctgccctctggatggcgtcatccagctacgaatctcccacgagcactacagcaagggc
ttccggcaggccgtgtcggttgttgtagccatggagaagctaaggaagatgctggttccc
tgcccacagaccttccaggacaatgacctgagcaccttgtttcccttcatctttgaagaa
gaacctatcttcctcgacacatgcaataacgacccttatgtgcatgatgcacctgtacga
tcactgcactgcacactccgggatgcacagctaaaaagcttggtgatgtctggtccatat
gaactgaaagctctccacctccagggacaggatctggagcaacaagtggtgttctccatg
tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggca
aagaacctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagc
gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata
gaaatcaataacaaggtggaatttgagtctgcccaattcccaaactggtacatcagcacc
tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggtggccaggatataact
gacttcaccatgcaatttgtgtcttcctaa

DBGET integrated database retrieval system