KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542550
Entry
108542550         CDS       T04641                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108542550 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rbb04054]
    108542550 (NLRP4)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Other autophagy associated proteins
   Others
    108542550 (NLRP4)
Pattern recognition receptors [BR:rbb04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   108542550 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_22 VirE AAA_14 DAP3 ATPase_2
Other DBs
NCBI-GeneID: 108542550
NCBI-ProteinID: XP_017748090
UniProt: A0A2K6M777
LinkDB
Position
Un
AA seq 1001 aa
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKRIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTQTYQAHAKQKFSRLWSSKSVTEIH
LYFQAEVRQEECEHLDHLFAPTETGKQPRTVVIQGPQGIGKTTLLMKLLMAWSDNKIFRD
RFLYTFYFCCRELRELPATSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGGL
NEPDSALCHDVMEKRPVQVLLSSLLRRKMLPEASLLVAVQPVCPKELRDRVAISEIYEPR
GFNESDRLVYFCCFFKDPKRALEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LTVTCQSTTSVYSSFIFNLFTPEGAEGPTPQSQCQLKALCSLAAEGMWTDTFEFREDDLR
RNGVVDADIPALLGTKVLLKYGERESSYVFLHACVQEFCAALFYLLKSHLDHPHPAVRCV
QELLIAHFEKTRRAHWIFLGCFLTGLLNKQEQQKLDAFFGFQLSQEIKQQLHQCLKSLGE
HGDPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLHKADFHIIDNADLVVSAYCLKYCSSLR
KLSFSVQNVFKKEDEHSSTSDYSLVCWHHICSVLTTSGHLTELQVQDSTLSESTFVTWCN
QLRHPSCRLQRLGINNVSFSGPSGQLFEVLFYQPDLKYLSFTLTKLSRDDVRSLCDALNY
PAGNVKELALVNCFLSPIDCEVLAFLLTNNKKLTYLNVSCNHLDTGLPLLCEALCNPDTV
LVYLMLAYCHLSEQCCEYISEMLLHNKSVRYLDLGANVLKDEGLKTLCEALKRPDCRLDS
LCLVKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVKLLCGALMRPDCHLEILGL
EECGLTSTCCKDLASVLTSSKTLQQLNLTLNALDYAGVVVLCEALRHPECALQVLGLRKT
DFDEETQALLMAEEERNPNLTITDDCDTITRVESDCEEPGL
NT seq 3006 nt   +upstreamnt  +downstreamnt
atggcagcctctttcttctctgattttggtcttatgtggtatctagaggagctcaaaaag
gaggagttcaggaaatttaaggaacacctcaagcaaatgactttgcatcttgaactcaag
cggattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaacctcttgatc
aagcactatgaagaacaacaagcttggaacataaccttaagaatctttcaaaagatggat
agaaaggatctctgcatgaaggtcatgagggagagaacaggatacacacaaacctatcaa
gctcatgcaaagcagaaattcagccgcttatggtccagcaagtctgtcactgagattcac
ctgtacttccaggcggaagtcaggcaagaagaatgtgaacatttggaccacctttttgct
cccacggaaactgggaaacagccgcgtacggtggtcattcagggaccgcaaggaattggg
aaaacgacactcctgatgaagctgctgatggcctggtcagacaacaagatctttcgggac
aggttcctgtacactttctatttctgctgcagagaactgagggagttgccagcaacgagc
ttggcggacctgatttccagagagtggcccgaccccgctgccccgataacagagatcgtg
tctcagccggagagactcttgtttgtcatcgacagcttcgaagagctgcagggcggcttg
aacgaacccgactcggctctgtgccacgacgtgatggagaaacggccggtgcaggtgctt
ctgagcagtttgctgaggaggaagatgctcccggaggcctccctgctcgtggccgtccaa
cccgtgtgcccgaaggagctccgggatcgggtggcgatctcagaaatctacgagccccgg
ggattcaacgagagcgatcggttagtgtatttttgctgtttctttaaagacccgaaaaga
gccctggaagcctttaatcttgtaagagaaagtgagcaactgttttccatatgccaaatc
ccgctcctctgctggatcctgtgtacttctctgaagcaagagatgcagaaaggaaaagac
ctgaccgtgacctgccagagcactacctctgtgtactcctctttcatctttaacttgttc
acacccgagggtgccgagggtcccactccgcaaagccagtgccagctgaaggccctgtgc
tccctggctgcagagggcatgtggacggacacgtttgagtttcgtgaagacgacctccgg
agaaatggggttgttgacgctgacatccctgcactgctgggcaccaaggttctcctgaag
tacggggagcgtgagagctcctacgtgttcctccacgcatgtgtccaggagttctgtgct
gccttgttctatttgctcaagagccaccttgatcatcctcacccggccgtgagatgtgta
caggaattgctaattgcccattttgaaaaaacaaggagggcacattggatttttctgggg
tgttttctaactggccttttaaataaacaggaacaacagaaactggacgcgttttttggc
ttccagctgtcccaagagataaagcagcaacttcaccagtgcctgaagagcttaggggag
catggtgatcctcagggacaggtggattccttggcgatattttactgtctctttgagatg
caggatcctgcctttgtaaagcaggcagtgaacctcctccacaaagctgactttcatatt
attgacaacgcagacctggtggtttctgcctactgcttaaaatactgctccagtttgagg
aaactctctttttccgttcaaaatgtctttaagaaagaggatgaacatagctctacgtcg
gattacagcctcgtctgttggcatcacatctgctctgtgctcactaccagcgggcacctc
acagagctgcaggtacaggacagcaccctcagcgagtcgacctttgtgacctggtgtaac
cagctgaggcatcccagctgtcgtcttcagaggctcggaataaataatgtttccttttct
ggtccgagtggtcagctctttgaggtgcttttttatcagccagacttgaaatacctgagc
ttcaccctcacgaaactctctcgtgatgacgtcaggtccctctgtgacgccttgaactac
ccagcgggcaacgtaaaagagctagcgctggtaaattgtttcctctcacccatcgattgt
gaagtccttgccttccttctaaccaacaacaagaagctgacgtatctgaatgtgtcctgc
aaccacttagacacgggcttgcctcttctgtgtgaagcgctgtgcaacccagacacggtc
ctggtatacctgatgctggcttactgccacctcagtgaacagtgctgcgaatacatctct
gaaatgcttctgcataacaagagcgtgcgctatctagacctcggcgccaatgtcctgaag
gacgaaggactgaagaccctctgcgaggccttgaaacgcccagactgccgcctggattcg
ctgtgtttggtaaaatgttttatcactgctgctggctgtgaagaccttgcctctgctctc
atcagcaatcaaaacctgaagattctgcaaattgggtgcaatgaaatcggagatgtgggc
gtgaagctattgtgtggggctctgatgcgtccggattgccatttagagattcttgggttg
gaagaatgtgggttaacgagcacctgctgtaaggatctcgcgtctgttctcaccagcagt
aagaccctgcagcagctcaacctgaccttgaacgccttggactacgcaggggtggttgtg
ctctgtgaggccttgagacacccagagtgcgccctgcaggtgctcgggctgagaaaaact
gattttgatgaggaaacccaggcacttctgatggctgaggaagagagaaatcctaacctg
accatcacagacgactgtgacacaattacaagggtagaatctgattgcgaggaacctggg
ctctga

DBGET integrated database retrieval system