KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542604
Entry
108542604         CDS       T04641                                 

Gene name
CUL2
Definition
(RefSeq) cullin 2
  KO
K03870  cullin 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108542604 (CUL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108542604 (CUL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108542604 (CUL2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108542604 (CUL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108542604 (CUL2)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Cullin
     108542604 (CUL2)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 108542604
NCBI-ProteinID: XP_017748171
LinkDB
Position
Un
AA seq 464 aa
MQNVIISFDKRKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTL
FVESVLKVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNL
LKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMI
NKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWP
LTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVENELFGQTICDSSL
RPIPKWQFFLPFNNSRNGHGKLMLCATGGTAFSCRQAIYNGYFVTAAFEDIDAESSFSLN
MNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQ
EVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcagaatgtcataatatcattcgacaagagaaaaaaaaatgacatggcaaatatgtac
gtcttactccgtgctgtgtccactggtttacctcatatgattcaggagctacaaaaccac
atccatgatgagggccttcgagcaaccagcaaccttactcaggaaaacatgccgacacta
tttgtggagtcagttttgaaagtgcatggtaaatttgttcaacttatcaacactgttttg
aatggtgatcagcacttcatgagtgcattggataaggcccttacgtcggttgtaaattac
agagaacctaagtctgtttgcaaagcacctgaactgcttgctaagtactgtgacaactta
ctgaagaagtcggcgaaagggatgacagagaatgaagtggaagacaggctcacgagcttc
atcacggtgttcaaatatattgatgacaaggatgtctttcaaaagttctacgcaagaatg
ctggcaaaacgtttaattcatgggttatccatgtctatggactctgaagaagccatgatc
aacaaattaaagcaagcctgtggttatgagtttaccagcaagctacatcggatgtataca
gatatgagtgtcagcgctgatctcaacaataagttcaacaattttatcaaaaaccaagac
acagtaatagatttgggaattagttttcaaatatatgttctacaggctggtgcatggcct
cttactcaggctccttcatctacatttgcaattccccaggaattagaaaaaagtgtacag
atgtttgaattattttatagccaacatttcagtggaaggaaacttacatggttacattat
ctgtgtacaggtgaagttgaaaatgaactatttgggcaaaccatatgtgactcatcgtta
cgacccataccaaaatggcagttcttcttgccctttaacaacagtcgaaatggtcacggc
aaattgatgctgtgtgctactggaggcacagccttctcctgccgtcaggccatttacaat
gggtattttgttactgcagcatttgaagatattgatgcagaatcttcattttcattaaat
atgaactttagcagtaaaagaacaaaatttaaaattactacatcaatgcagaaagacaca
ccacaagaaatggagcagactagaagtgcagtcgatgaggaccggaaaatgtatctccaa
gctgctatagttcgtatcatgaaagcacgaaaagtgcttcggcacaatgcccttattcaa
gaggtgattagtcagtcaagagctaggtttaatcccagtatcagcatgattaagaagtgt
attgaagttctgatagacaaacagtacatcgaacgcagccaggcgtcggcagatgaatac
agctatgtcgcatga

DBGET integrated database retrieval system