KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543072
Entry
108543072         CDS       T04641                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta
  KO
K08528  retinoic acid receptor beta
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108543072 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    108543072 (RARB)
   05222 Small cell lung cancer
    108543072 (RARB)
   05223 Non-small cell lung cancer
    108543072 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108543072 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rbb03310]
    108543072 (RARB)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    108543072 (RARB)
Nuclear receptors [BR:rbb03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   108543072 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 108543072
NCBI-ProteinID: XP_017748895
LinkDB
Position
Un
AA seq 455 aa
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccactagcggccacgcatgtccggtcccagcagtgaacggacacatgactcactat
ccagccacaccctacccattactttttccacctgtcatcggaggactttccctgcctcct
ctccatggccttcatggacatccgcctccgagtggatgcagcaccccatcaccagcaaca
attgaaacacagagcaccagctctgaggaactcgtcccaagccccccatctccacttcct
ccccctcgagtgtacaaaccctgcttcgtctgccaggacaaatcatcagggtaccactat
ggggtcagcgcctgtgagggatgtaagggctttttccgcagaagtattcagaagaatatg
atttacacttgtcaccgagataagaactgtgttattaataaagtcaccaggaatcgatgc
caatactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatctgtcaggaat
gacaggaacaagaaaaagaaggagacttcgaagcaagaatgcacagagagctatgaaatg
acagctgagttggacgatctcacagagaagatccgaaaagctcaccaggaaactttccct
tcgctctgccagctgggtaaatacaccacgaattccagtgctgaccatcgagtccgactg
gacctgggcctctgggacaaattcagtgaactggccaccaagtgcattattaagatcgtg
gagtttgctaaacgtctgcctggtttcactggcttgaccatcgcagaccaaatcaccctg
ctgaaggccgcctgcctggacatcctgattcttagaatttgcaccaggtataccccagaa
caagacaccatgactttttcagacggccttaccctaaatcgaactcagatgcacaatgct
ggatttggtcctctgactgaccttgtgttcacctttgccaaccagctcctgcctttggaa
atggatgacacagaaacaggccttctcagtgccatctgcttaatctgtggagaccgccag
gaccttgaggaaccgacaaaagtagataaactacaagaaccattgctggaagcactaaaa
atttatatcagaaaaagacgacccagcaagcctcacatgtttccaaagatcttaatgaaa
atcacagatctccgtagcatcagtgctaaaggtgcagaacgtgtaattaccttgaaaatg
gaaattcctggatcaatgccacctctcattcaagaaatgctggagaattctgaaggacat
gaacccttgaccccaagttcaagtgggaacacagcagagcacagtcctagcatctcaccc
agctcagtggaaaacagtggggtcagtcagtcaccactcgtgcaataa

DBGET integrated database retrieval system