KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543264
Entry
108543264         CDS       T04641                                 

Gene name
KLF2
Definition
(RefSeq) Kruppel like factor 2
  KO
K17845  krueppel-like factor 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04068  FoxO signaling pathway
rbb04371  Apelin signaling pathway
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108543264 (KLF2)
   04068 FoxO signaling pathway
    108543264 (KLF2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108543264 (KLF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbb03000]
    108543264 (KLF2)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    108543264 (KLF2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 108543264
NCBI-ProteinID: XP_017749168
LinkDB
Position
Un
AA seq 249 aa
MNPGDSRLPIHPGFCGPLKLEPISPSVKGSGEAAKPGAPLSFREAPTPPPLQVPGMLAQA
GARGARGIPGRHAAVVQRVLTTSPGRPAGAGPGPGFGAPGPGLHYAPPAPPAFGLFDDAA
AAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKS
SHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDH
LALHMKRHM
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaatcctggagactccaggcttcccatccacccagggttctgcggacctctgaagctg
gagccaatctccccttccgtcaagggatccggggaggccgccaagcccggtgctcccctg
agtttccgagaggccccgacaccgcccccgctccaggtccccgggatgctcgcgcaggcg
ggagcccggggcgcccgggggatccctgggcgtcacgccgctgttgtgcagcgcgtgttg
acaacgtcgccggggagaccggcgggggcggggcccggccccggcttcggcgcgcctggg
cccggcctgcattacgcgccgcctgcgcccccagccttcggtctctttgacgacgcggcc
gccgccgcggcagccctgggtctggcgccccccgccgcccgcggtctcctcacgccgcct
gcgtccccactggagctgctggaggccaagccaaagcggggccgtcgctcctggccccgc
aaacgcaccgccactcacacctgcagctacgcgggctgcggcaagacctacaccaagagt
tcgcatctgaaggcgcatctgcgcacgcacacaggtgagaagccctaccactgcaactgg
gacggctgtggctggaagtttgcgcgctcagacgagctcacacgccactaccgcaagcac
acgggccaccggcctttccagtgccatctgtgcgatcgtgccttctcgcgctccgaccac
ctggccttgcacatgaaacggcacatgtag

DBGET integrated database retrieval system