KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543621
Entry
108543621         CDS       T04641                                 

Gene name
FHIT
Definition
(RefSeq) fragile histidine triad
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00230  Purine metabolism
rbb01100  Metabolic pathways
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108543621 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108543621 (FHIT)
   05223 Non-small cell lung cancer
    108543621 (FHIT)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     108543621 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 108543621
NCBI-ProteinID: XP_017749701
LinkDB
Position
Un
AA seq 176 aa
MLCRIVMRRAHCSPGLESLFADFSCEDMSFRFGQHLIKPSVVFLKTELSFALVNRKPVVP
GHVLVCPLRPVERFHDLRPDEVADLFQVTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVK
HVHVHVLPRKTGDFHRNDSIYEKLQKHDKEEEDSPVSWRSEEEMAEEAAALRVYFQ
NT seq 531 nt   +upstreamnt  +downstreamnt
atgctgtgtagaatcgtaatgagacgtgcccattgctctccagggttggagtcactgttt
gctgacttcagctgtgaggacatgtcgttcagatttggccaacatctcatcaagccctct
gtggtgtttctcaaaacagaactgtccttcgctcttgtgaataggaaacctgtggtacca
ggacatgtcctcgtgtgcccgctgcggccagtggagcgcttccacgacctgcgtcctgat
gaagtggctgatttgtttcaggtgacccagagagtcgggacagtggtggaaaaacatttc
cacgggacctctctcaccttttccatgcaggatggccccgaagctggacagactgtgaag
cacgttcacgtccatgttcttcccaggaagactggagactttcacaggaatgacagcatc
tatgagaagctccagaaacatgacaaggaagaggaggactccccagtctcttggagatca
gaggaggaaatggcagaagaagctgcagctctgcgggtctactttcagtga

DBGET integrated database retrieval system