KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108544148
Entry
108544148         CDS       T04641                                 

Gene name
PTK2
Definition
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04012  ErbB signaling pathway
rbb04062  Chemokine signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04510  Focal adhesion
rbb04670  Leukocyte transendothelial migration
rbb04810  Regulation of actin cytoskeleton
rbb04935  Growth hormone synthesis, secretion and action
rbb05100  Bacterial invasion of epithelial cells
rbb05135  Yersinia infection
rbb05146  Amoebiasis
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05205  Proteoglycans in cancer
rbb05222  Small cell lung cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108544148 (PTK2)
   04370 VEGF signaling pathway
    108544148 (PTK2)
   04151 PI3K-Akt signaling pathway
    108544148 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108544148 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108544148 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    108544148 (PTK2)
   04062 Chemokine signaling pathway
    108544148 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    108544148 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    108544148 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108544148 (PTK2)
   05202 Transcriptional misregulation in cancer
    108544148 (PTK2)
   05205 Proteoglycans in cancer
    108544148 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108544148 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108544148 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108544148 (PTK2)
   05100 Bacterial invasion of epithelial cells
    108544148 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108544148 (PTK2)
   05163 Human cytomegalovirus infection
    108544148 (PTK2)
   05165 Human papillomavirus infection
    108544148 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108544148 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108544148 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108544148 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:rbb01009]
    108544148 (PTK2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108544148 (PTK2)
Protein kinases [BR:rbb01001]
 Non-receptor tyrosine kinases
  FAK family
   108544148 (PTK2)
Protein phosphatases and associated proteins [BR:rbb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108544148 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 108544148
NCBI-ProteinID: XP_017750599
LinkDB
Position
Un
AA seq 1093 aa
MADCIAELGLLCIFQLQIQCLLQFPQSSSRITEEYDRYLASSKIMAAAYLDPNLNHTPNS
STKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFIIRPQKEGERALPSIPKL
ANSEKQGMRTHTVSVSDEISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIE
LGRCIGEGQFGDVHQGVYMSPNNYGELFSLVTMRQFDHPHIVKLIGVITENPVWIIMELC
TLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKL
GDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKP
FQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEE
EKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHY
QVSGYPGSHGITAMAGSIYPGQTSLLDQTDSWNHRPQEIAMWQPNVEDSTALDLRGIGQV
LPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ
PVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKPWRLQPQEISPPPTANLDR
SNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPAST
HREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVID
QARLKMLGQTRPH
NT seq 3282 nt   +upstreamnt  +downstreamnt
atggctgactgtattgcagaactggggctcctttgcatcttccagttacaaattcagtgc
cttctgcagtttccccagagctcctcaagaataacggaagaatatgacagatacctagca
tctagcaaaataatggcagctgcttaccttgaccccaacttgaatcacacgccaaattcg
agtactaagactcacctgggtactggtatggaacgttctcctggtgcgatggagcgagta
ttaaaggtctttcattattttgaaagcaatagtgagccaaccacctgggccagtattatc
aggcatggagatgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcatgtggcctgctatggattccgcctcagtcacctgcggtcagaggaggttcac
tggcttcacgtggatatgggcgtctccagtgtgagggagaagtatgagcttgcccaccca
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagataagccaactttgaatttcttctatcaacaggtgaagagcgattatatg
ttagagatagctgatcaagtggaccaggaaattgctttgaagttgggttgtctagaaata
cggcgatcatactgggagatgcggggcaatgcactagaaaagaagtctaactatgaagta
ttagaaaaagatgttggtttaaagcgattttttcctaagagtttactggattctgtcaag
gccaaaacactaagaaaattgatccaacaaacatttagacaattcgccaaccttaataga
gaagaaagtattctgaaattctttgagatcctgtctccagtctacagatttgataaggaa
tgcttcaagtgtgctcttggttcaagctggattatttcagtggaattggcaatcggccca
gaagaagggatcagttacttgacggacaagggctgcaatcccacacatcttgctgacttt
actcaagtgcagaccattcagtattcaaacagtgaagataaggacagaaaaggaatgcta
caactaaaaatagcaggtgcacctgagcctctgacagtgacggcaccatccctaaccatt
gcggagaatatggctgacctgatagatgggtattgccggctggtgaatggagcctcgcag
tcatttatcatcagaccccagaaagaaggtgaacgggctttgccatcaataccaaagttg
gccaacagcgaaaagcaaggcatgcggacacacaccgtctctgtgtcagatgaaattagt
ggggacgaaacagatgattatgctgagattatagatgaagaagatacttacaccatgccc
tcaaaaagctatggaatagatgaagccagggattatgagattcaaagagaaagaatagaa
cttggacgatgtattggagaaggccaatttggagatgtacatcaaggcgtttatatgagt
ccaaataactatggagaacttttttccctagtaacaatgcgtcagtttgaccatcctcat
attgtgaagctgattggagtcatcacagagaatcctgtctggataatcatggagctgtgc
acacttggagagctgaggtcatttttgcaagtaaggaaatacagtttggatctagcatct
ttgatcttgtatgcctatcagcttagtacagctcttgcatatctagagagcaaaagattt
gtacacagggacattgctgctcggaatgttctggtgtcctcaaatgattgtgtaaagtta
ggagactttggattatcccgatatatggaagatagtacttactacaaagcttccaaagga
aaattgcctattaaatggatggctccagagtcaatcaattttcgacgttttacctcagct
agtgacgtatggatgtttggtgtgtgtatgtgggagatactgatgcatggtgtgaagcct
tttcaaggagtgaagaacaatgatgtgatcggtcgaattgaaaatggggaaagattacca
atgcctccaaattgtcctcctaccctctacagccttatgacgaaatgctgggcctatgac
cccagcaggcggcccaggtttactgaacttaaagctcagctcagcacaatcctggaggaa
gagaaggctcagcaagaagaacgcatgaggatggagtccagaagacaggccacagtgtcc
tgggactccggagggtctgatgaagcgccacccaagcccagcagaccgggttatcctagt
ccgaggtccagcgaaggattttatcccagcccacagcacatggtacaaaccaatcattac
caggtttctggctaccctggttcacatggaatcacagccatggctggcagcatctatcca
ggtcagacatctcttttggaccaaacagattcatggaatcatagacctcaggagatagca
atgtggcagcccaatgtggaggactctacagcattggacctgcgagggattgggcaagtg
ttgccaacccacctgatggaagagcggctaatccgacaacaacaggaaatggaagaagat
cagcgctggctggaaaaagaggaaagatttctgaaacctgatgtgagactctctcgaggc
agtattgacagggaggatggaagtcttcagggtccgattggaaaccaacatatatatcag
cctgtgggtaaaccagatcctgcagctccaccaaagaaaccgcctcgccctggagctccc
ggtcacctgggaagccttgccagcctcagcagccctgctgacagctacaacgagggtgtc
aagccatggaggcttcagccccaggaaatcagcccccctcctactgccaacctggaccgg
tcaaatgataaggtgtacgagaatgtgacgggcctggtgaaagctgtcatcgagatgtcc
agtaaaatccagccagccccaccagaggagtatgtccctatggtgaaggaagtcggcttg
gccctgaggacgttattggccactgtggatgagaccattcccctcctaccagccagcacc
caccgagagattgagatggcacagaaactattgaactctgacctgggtgagctcatcaac
aagatgaaactggcccagcagtatgtcatgaccagtctccagcaagagtacaaaaagcaa
atgctgactgctgctcacgccctggctgtggatgccaaaaacttactcgatgtcattgac
caagcaagactgaaaatgcttgggcagacgagaccacactga

DBGET integrated database retrieval system