KEGG   Rhodanobacteraceae bacterium Dysh456: ALSL_1079Help
Entry
ALSL_1079         CDS       T06043                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rbd  Rhodanobacteraceae bacterium Dysh456
Pathway
rbd00480  Glutathione metabolism
rbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ALSL_1079
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbd02000]
    ALSL_1079
Enzymes [BR:rbd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ALSL_1079
Transporters [BR:rbd02000]
 Other transporters
  Pores ion channels [TC:1]
   ALSL_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_2 GST_C GST_C_3 GST_N_3 GST_N_2 GST_C_5 GST_C_6
Motif
Other DBs
NCBI-ProteinID: BBD79742
UniProt: A0A2Z6E4A3
LinkDB All DBs
Position
1154864..1155469
Genome map
AA seq 201 aa AA seqDB search
MKLYYSPGACSLSPHIALRESGLPFELVRVDLKTKQTEDGRDYRSINPAGYVPLLELDDG
HTLSEGPAILQYVADQAPAKHLAPPNGSFERYRLQQWLNFIATELHKNFSPLFRPDTTDE
GKQAAVQMLGNRFEVVAAQLAQSPYLLGNELSVADIYLFVVLSWTRYAGIDLAQWPALKA
FMERVGSREAVRAALQAEGLA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctactacagccccggtgcctgctcgctctcaccgcacatcgcgctgcgtgaa
agcggcctgcctttcgaactcgtccgcgtcgatctcaagaccaagcagaccgaggacggc
cgcgactaccgctcgatcaacccggccggctacgtgccactcctggagctcgatgatggc
cacaccctgagcgaaggcccggcgatcctgcagtacgtcgccgaccaggcgccggccaag
catctggcgccgcccaatggaagcttcgagcgctaccgcttgcagcagtggctcaatttc
atcgccaccgagctgcacaagaacttcagtccgctgttcaggcccgacaccaccgacgag
ggcaagcaggcggcggtgcagatgctcggcaaccgcttcgaggtggtcgccgcgcagctt
gcgcagagcccttatctgctcggcaacgagttgagtgtcgccgacatctatctcttcgtg
gtgctgagctggacccgttatgcgggcatcgatctggcgcagtggcccgcgctcaaggcc
ttcatggagcgcgtcggcagccgcgaggccgtgcgcgccgcgttgcaggccgaaggcctg
gcctga

DBGET integrated database retrieval system