KEGG   Rickettsia bellii RML369-C: RBE_1188Help
Entry
RBE_1188          CDS       T00339                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
rbe00061  Fatty acid biosynthesis
rbe00780  Biotin metabolism
rbe01100  Metabolic pathways
rbe01212  Fatty acid metabolism
Module
rbe_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rbe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RBE_1188 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RBE_1188 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rbe01004]
    RBE_1188 (fabZ)
Enzymes [BR:rbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     RBE_1188 (fabZ)
Lipid biosynthesis proteins [BR:rbe01004]
 Fatty acid synthase
  Component type
   RBE_1188 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT AfsA
Motif
Other DBs
NCBI-ProteinID: ABE05269
UniProt: Q1RH95
LinkDB All DBs
Position
complement(1279481..1279918)
Genome map
AA seq 145 aa AA seqDB search
MTIDITEIMDLIPHRYPFLLVDKVVEIDPNKSITGIKNVTVNEPQFTGHFPARPVMPGVL
MVEAMAQLAAILVAKSLGSTKNKEVFLMAIENSKFRKVVQPGDTMHIHATIDQQRANVWK
FSSTVKVDGEMAAESKFTAMIKDKS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgatattaccgaaattatggatttgatacctcatcgttatccgtttttatta
gtggataaagtagttgaaattgatcctaataaatcaataactggcattaaaaatgttact
gttaatgagccacaatttacaggtcattttccggcaagacctgttatgcctggagtttta
atggttgaagctatggcacagcttgcagctatattagttgctaaatctcttggctctact
aaaaataaagaagtgtttttaatggctatcgagaactcaaaatttcgcaaagttgttcag
ccaggggatacaatgcatattcatgctactattgatcagcaaagagctaatgtatggaag
ttttcaagtacggttaaagttgatggtgaaatggcagcggagagtaaatttaccgcaatg
atcaaagataaatcttaa

DBGET integrated database retrieval system