KEGG   Rhodobaca barguzinensis: BG454_06175Help
Entry
BG454_06175       CDS       T05218                                 

Definition
(GenBank) dimethlysulfonioproprionate lyase DddL
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
rbg  Rhodobaca barguzinensis
Pathway
rbg00920  Sulfur metabolism
rbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbg00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BG454_06175
Enzymes [BR:rbg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     BG454_06175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ATX65465
UniProt: A0A2K8KCM8
LinkDB All DBs
Position
complement(1296206..1296883)
Genome map
AA seq 225 aa AA seqDB search
MDQPAPPLLMTSRPAWVYLLRDFLEMYRMIPAGGSATIRAHQRLVRERISGVLRANPSLR
DSDAAHKPVTAHLQRALDQGRGTPMSRVIRSIDGLRDQLSWQYGYEKVPRGLDQKYAYTE
LVGPTGPVPSDQIILGLVLFAPGCIYPAHAHDGITESYICLSGAMSQNDQGVYVPGSMIF
NPPGQMHRITVADLEPSLLAYAWIGPPEKLVSQKMVFSRKTRRPG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcctgccccaccactcttgatgaccagccggcctgcatgggtctatttgctg
cgtgactttctggaaatgtatcgcatgattcctgctggcggcagcgcgaccatccgggcg
catcaacggctggtgcgcgaacgcatctcgggtgtcctgcgcgccaaccccagccttcgg
gacagcgatgccgcccacaaacctgtcaccgcgcatctgcaacgcgccttggaccaaggg
cgcggcaccccaatgtcccgcgtgatccgcagcattgatgggctgcgcgaccagctttca
tggcaatatgggtatgagaaagtgccgcgcgggctggatcagaaatatgcctataccgaa
ctggtcggccccacaggacctgtgcccagcgatcagatcatccttgggctggtgctgttc
gcgcccggctgtatctatcccgcccatgcgcatgacgggatcaccgaaagctatatctgc
ctgtctggcgccatgtcgcagaatgatcagggggtgtatgtccccggttcgatgatcttc
aacccgcccggacagatgcaccggatcacggtggccgatctggaaccttcgcttctggcc
tatgcctggatcggaccgcccgagaagctggtctcgcaaaaaatggttttcagccggaaa
acccggcgaccgggctag

DBGET integrated database retrieval system