KEGG   Rhodobaca barguzinensis: BG454_07405Help
Entry
BG454_07405       CDS       T05218                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rbg  Rhodobaca barguzinensis
Pathway
rbg00564  Glycerophospholipid metabolism
rbg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BG454_07405
Enzymes [BR:rbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BG454_07405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 NAD_binding_8 FAD_oxidored GIDA FAD_binding_2 FAD_binding_3 HI0933_like Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ATX65672
UniProt: A0A2K8K886
LinkDB All DBs
Position
1553372..1554994
Genome map
AA seq 540 aa AA seqDB search
MPRSDEGKATPETVHDLVIIGGGINGCGIARDAAGRGLSVALFEKGDLAGATSSASTKLF
HGGLRYLEFFEFRLVREALMERETLLRAMPHISWPMRFILPYHEDMRFESDTPTSKLLSR
LMPWMKGRRPAWLIRLGLFLYDNLGGRKILAATATRALAATPEGAPLQDRFAKAYEYSDC
WVEDARLVVLNARDAEARGARIHTRAEVTSATALVDGSWQITVKTESETKTVRAKMLVNA
AGPWVGDVIHAKLRLNSRENVRLVRGSHIVTRKLYDHDKCYFFQGTDGRIIFAIPYEQDF
TLIGTTDAEHDDPSRAPVCTDEERDYLCDFASAYFAQPVTAADVVWTYSGVRPLYDDGAS
SATAATRDYTLKIDRSAGAPVLNIFGGKITTYRRLAESALEKIGTVLPVAKGAWTAGVAL
PGGDFAHDGVPALVAGLQRDYPFLSDFWARRLVRAYGTQARTILGGAKTADDLGQDFGAT
LTQAEVTWLMTREYAHSAEDVLWRRSKLGLRLDQAQVAVLDDWMARNRLNAGTEAGNLKV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgatccgatgaaggaaaggccaccccagagactgttcatgatcttgtgatcata
ggtggcggtatcaatggctgtgggattgcgcgtgacgcggcagggcggggcctttcagtg
gcgttgttcgagaaaggcgaccttgcgggcgcaacctcttcggcgtcgaccaagctgttc
cacggcgggttgcggtatctggagtttttcgagtttcgccttgtacgcgaggcattgatg
gaacgcgagacgctgttgcgtgcaatgccccatatttcatggccgatgcgctttatcctt
ccttatcatgaagatatgcgcttcgagagtgatacgccaacgtctaaactgttgtcacgg
cttatgccctggatgaaggggcgtcgccctgcttggctgatccggttggggctgtttctg
tatgacaatctgggcgggcgcaagattcttgcagcaacagccacccgcgcactggccgcc
acgccagagggggcgcccctgcaggaccggtttgcgaaagcctatgaatattcggattgc
tgggtcgaggatgcgcgtctggtggtcctgaatgcccgcgatgcagaggcgcgcggcgcg
cgcattcatacgcgggcagaggtgacctcggccactgcgctggtggatggtagctggcag
atcacagtcaaaaccgaaagtgaaacgaaaactgttcgtgcgaaaatgctggtgaatgcg
gccgggccttgggtgggggatgtaattcacgccaaactgcgcctcaatagccgcgagaat
gtgcgccttgtgcgtggcagtcatatcgtgactcgcaagctttatgatcatgacaaatgc
tatttctttcagggcacggatggacggatcatctttgccattccctatgagcaggatttt
accctgatcggcacgactgatgcggaacatgacgacccgtcgcgcgcgcccgtctgcacg
gatgaagagcgtgattatctgtgcgactttgccagcgcgtatttcgcccagcccgtcacc
gcggcggatgtggtctggacctattccggcgtgcgcccgctctatgatgacggggcaagt
tcggccacggcggccacgcgcgactataccttgaagattgatcgaagtgcgggcgcgcct
gttctgaacatttttggcggcaagatcacgacataccggcggctggccgagtctgcattg
gagaagattggcaccgtcctgcctgtcgccaaaggggcatggaccgcaggtgtggcgctt
ccggggggggattttgcgcatgatggtgtgcccgcgctggtggcgggattgcagcgcgat
tatccgttcctaagcgatttctgggcgcggcgactggtgcgcgcctatggcactcaagcc
cgcactatccttggcggtgcgaaaaccgccgatgatctggggcaggacttcggggctacc
ctgacccaggcggaggtcacatggctgatgacccgcgaatatgcccatagcgccgaagat
gtgctgtggcggcgctcgaagctgggtttgcggttggatcaggcgcaggtcgcggttctg
gatgactggatggcgcgcaaccggttgaacgcgggcacggaagcaggcaatctgaaagta
tga

DBGET integrated database retrieval system