KEGG   Rhodobaca barguzinensis: BG454_08760Help
Entry
BG454_08760       CDS       T05218                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rbg  Rhodobaca barguzinensis
Pathway
rbg00240  Pyrimidine metabolism
rbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BG454_08760
Enzymes [BR:rbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BG454_08760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: ATX65907
UniProt: A0A2K8K8X7
LinkDB All DBs
Position
1833226..1833819
Genome map
AA seq 197 aa AA seqDB search
MAKLYFHYSTMNAGKSTVLLQAAHNYRERGMQPILLTAALDDRAGPSRIASRIGICAPAQ
TFTPQTDMFACLEGARQQGPVHCVFIDEAQFLTEAQVWQLARAVDDLHLPVMCYGLRVDF
RGQLFPGSAVLLALADEMREVRTICHCGKKATMVVRMGPDGVALQEGAQVQIGGNETYVS
LCRRHWRAAMERQPDQD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggccaaattgtatttccattattcgaccatgaatgcgggcaaatcgaccgtgctgttg
caggcggcccataattaccgcgaacgcggcatgcagccaatattgttgacggcagcgctt
gatgatcgtgcagggccatctcgaatagcctcgcgtatcgggatctgcgcgcccgcgcag
acattcacaccgcaaaccgacatgttcgcctgcctcgagggcgcgcggcagcaagggcct
gtgcattgcgtattcattgatgaggcgcagtttctgaccgaagcgcaggtctggcaactc
gcgcgtgccgtggatgatctgcacctgccggtcatgtgctatggtctgcgcgtcgatttt
cgtggccagcttttccccggatcggctgtgttgctggcattggcggatgagatgcgcgaa
gtgcgcaccatctgccattgcggcaaaaaggccacgatggttgtccgcatggggccggat
ggcgtggcgctgcaagaaggcgcacaggtgcagatcggggggaatgagacttatgtttca
ctctgtcggcggcattggcgcgcggccatggagcgccagccagatcaggactga

DBGET integrated database retrieval system