KEGG   Rhodobaca barguzinensis: BG454_08930Help
Entry
BG454_08930       CDS       T05218                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rbg  Rhodobaca barguzinensis
Pathway
rbg00061  Fatty acid biosynthesis
rbg00780  Biotin metabolism
rbg01100  Metabolic pathways
rbg01130  Biosynthesis of antibiotics
rbg01212  Fatty acid metabolism
Module
rbg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rbg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BG454_08930
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BG454_08930
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BG454_08930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rbg01004]
    BG454_08930
Enzymes [BR:rbg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BG454_08930
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BG454_08930
Lipid biosynthesis proteins [BR:rbg01004]
 Fatty acid synthase
  Component type
   BG454_08930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ATX65937
UniProt: A0A2K8K909
LinkDB All DBs
Position
complement(1866294..1867082)
Genome map
AA seq 262 aa AA seqDB search
MTGLMQGKRGLVMGVANERSIAWGIAAALAAEGAELAFSYQGEAFGKRVEPLAASLGSDL
LLDVDVSDDASMDAAFGKLRDSWGKMDFLVHAIAFSDKTELTGRFRDTSRANFAHSLNIS
CYSFIDVGRRASELMPDGGCLLTLTFQGSNSVTPYYNVMGVAKAALESSVRYLANDLGPE
GIRVNAISPGPMKTLAGAAIGGARKTFRHAEANAPLGTNATLQSVGGTAVYLASDYGSHT
TGEIIHVDGGYHVMGMPRVENI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccggactgatgcagggaaaacgcgggcttgttatgggcgtcgcgaatgagcgctcg
atcgcctggggtatagcggcggccctggcggctgagggggcagagcttgccttcagctat
cagggcgaggcgtttggcaaacgcgtcgaacccctggccgcgagtcttgggtcagacctg
cttctggatgtcgatgtcagtgatgacgcctcgatggacgcggcctttggcaagttgcgc
gacagctggggtaagatggattttctggtccatgccattgcattttcggacaaaacggaa
ctgaccgggcgttttcgtgacaccagtcgcgcaaactttgcgcattcgctgaacatcagt
tgctacagcttcattgatgtggggcgcagagcgtcagagctgatgcccgatggcggctgt
ctgctgacgctgacctttcagggatcaaactctgtcacgccatattacaacgtgatgggg
gtggccaaggccgcgctggaaagctctgtcaggtatcttgcaaatgatttggggccagag
gggatccgggtgaatgcgatcagccccggcccgatgaaaaccctggcaggcgcagccatt
ggcggggcgcgcaagacatttcgtcacgccgaagccaatgccccgcttggtacgaatgca
acgctgcaaagtgtgggtgggacagcggtctatctggcatctgattatggttcccataca
acgggcgaaatcatccatgtcgatggcggctatcacgtgatggggatgccgcgggtcgaa
aacatctag

DBGET integrated database retrieval system