KEGG   Rhodobaca barguzinensis: BG454_13375Help
Entry
BG454_13375       CDS       T05218                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rbg  Rhodobaca barguzinensis
Pathway
rbg00970  Aminoacyl-tRNA biosynthesis
rbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BG454_13375 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rbg03029]
    BG454_13375 (gatB)
Enzymes [BR:rbg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BG454_13375 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BG454_13375 (gatB)
Mitochondrial biogenesis [BR:rbg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BG454_13375 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: ATX66686
UniProt: A0A2K8KCJ3
LinkDB All DBs
Position
2766123..2767637
Genome map
AA seq 504 aa AA seqDB search
MLDLSFEPPKPKVISGATGAWELVIGMEIHAQVSSQAKLFSGASTRFGAEPNANVAFVDA
AMPGMLPVVNEFCIEQAVRTGLGLKAQINLRSAFDRKNYFYPDLPQGYQISQLYHPLVGE
GEVLVEMGAGIARLVRIERIHVEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYVTKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFDHLGTRC
EIKNMNSMRFIQAAIDYEARRQIAILEDGGSVVQETRLYDPDKGETRSMRSKEEAHDYRY
FPCPDLLPLEIEQAWVDEIAASLPELPDAKKARFMADFGLTDYDASVLTADVANAAYFEA
VAAQAGDGKLAANWVINELFGRLKKEGHDITDSPVSSAQLAGIIALIKAGDISGKIAKDL
FEIVYTEGGDPAQIVEARGLKQVTDAGAIEKAVDEIIAANPAQVEKAKQNPKLAGWFVGQ
VMKATGGKANPAAVNQIVSAKLGL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctggacctgagtttcgagccgcccaaacccaaggtaatctctggcgcgaccggcgca
tgggaactggtcatcgggatggagatccatgcgcaagtctccagtcaggccaaactgttt
tccggggcctcgacccgctttggcgctgaacccaatgccaatgtcgctttcgttgatgcg
gcaatgccgggcatgctgccggtcgtcaatgaattctgtatcgaacaggccgtgcgcacg
gggctggggctgaaggcgcagatcaacctgcgctcggcctttgaccggaaaaattacttc
tatcccgatctgcctcagggctatcagatcagccagctatatcacccgctggtgggtgaa
ggtgaagtgctggtggaaatgggcgcaggtatcgcgcgccttgtgcggatcgagcgcatt
catgtggaacaggatgcaggcaaatccatccatgacatggaccccaacatgtccttcgtt
gacctgaaccgcaccggcgtcgcgctgatggaaatcgtcagccgccccgacatccgcggg
ccagaggaagccgccgcctatgtcaccaaactgcgccagatcctgcgctatctgggcacc
tgtgatggcaatatgcagaacgggaacctgcgcgccgatgtgaacgtgtcggtctgccgc
cccggacaatatgagaagtaccaggaaacgcaggatttcgaccatcttggaacgcgctgc
gagatcaagaacatgaactccatgcggttcattcaggcggccatcgattatgaggcgcgc
cgccagatcgccatccttgaggatggcggcagcgtggtgcaggaaacgcggctctatgac
cctgacaagggcgagacacgctcgatgcggtccaaggaagaagcgcatgattaccgttac
ttcccctgccccgacctgttgccacttgaaatcgaacaggcttgggtcgatgagatcgcc
gccagcctgccagaactgccggatgcgaagaaagcgcgcttcatggcagatttcggcctg
accgactatgacgccagcgtgctgactgcggacgtggccaatgccgcctatttcgaggcc
gttgctgcgcaagcaggcgatggaaaactggcggccaactgggtgatcaacgagttgttc
gggcgattgaaaaaggaaggccatgacattacggacagccccgtttccagcgcgcaactg
gcaggaatcattgcgctgatcaaggcgggggatatctctggcaagatcgcgaaagacctg
ttcgagatcgtctatacagaaggcggcgatcccgcccagatcgtggaagcgcgcggcctg
aagcaggtgaccgacgctggcgcgatcgagaaggctgtggacgaaattatcgctgcgaat
ccggcgcaggtggagaaggccaaacagaaccccaaactggcgggctggtttgtggggcaa
gtgatgaaggcgactggcggcaaggccaaccccgcggccgtgaaccagatcgtcagcgcg
aaactggggctgtag

DBGET integrated database retrieval system