KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_00770Help
Entry
B4966_00770       CDS       T05394                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rbh01100  Metabolic pathways
rbh01110  Biosynthesis of secondary metabolites
rbh01130  Biosynthesis of antibiotics
rbh01230  Biosynthesis of amino acids
Module
rbh_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B4966_00770
Enzymes [BR:rbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     B4966_00770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33
Motif
Other DBs
NCBI-ProteinID: AUM01371
UniProt: A0A2K9LE32
LinkDB All DBs
Position
170544..171041
Genome map
AA seq 165 aa AA seqDB search
MMGAGKTTIGRELAKRCGMRFVDCDHEIEARTGVNIPTIFEIEGEAGFRRRESQVIDELT
QSDGVVLATGGGAVLDPANRALLAERGVVIYLNVPPQILWERTRNDRNRPLLQVPNPREH
IAALHRQRDPLYREIADIIVDGGRSNPASMVRQILKALESCEKWS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcgccggcaagaccaccatcggacgcgagttggcaaagcgctgcgggatgcgc
tttgtcgattgcgatcatgaaatcgaagcgcgcaccggcgtgaatatccccacgattttc
gaaatcgagggcgaggcggggtttcgccggcgcgaatcccaagtcatcgatgaactcacc
cagtccgacggcgtggtgctcgccaccggcggaggggcggtcctggatccagcgaatcgc
gcgctgttggccgagcgcggcgtggtgatctatctcaatgttccgccgcaaattttgtgg
gagcgcacccgcaatgaccgcaaccgcccgttgctacaggtgccgaatccgcgcgagcat
attgcggcgctgcatcgtcagcgcgatccgctttaccgggaaatcgccgacatcattgtt
gacggggggcggagcaaccccgctagcatggtgcggcagattctgaaggcgctggagtcc
tgcgaaaaatggtcttga

DBGET integrated database retrieval system