KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_01405Help
Entry
B4966_01405       CDS       T05394                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00030  Pentose phosphate pathway
rbh01100  Metabolic pathways
rbh01120  Microbial metabolism in diverse environments
rbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B4966_01405
Enzymes [BR:rbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     B4966_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AUL98980
UniProt: A0A2K9L785
LinkDB All DBs
Position
309085..310932
Genome map
AA seq 615 aa AA seqDB search
MAWTRKILRVNLSAGTCSAEALNMKWADEYLGSRGLATKYLVEEIDPKVDPLSPDNKLIM
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGFFGAEMKFAGWDMIIFEGKSPKPVY
LYVENDRAELRDAAHLWGTSCWHTEETIKKELQDPLVRVSSIGRAGENQVLFACVVNDLH
RAAGRSGVGAVMGSKNLKAVALRGTRGVGGIRDFPAFMKAVNDGKKVLADNAVTGQGLPK
YGTQVLMNVINEIGALPTRNHRDVQFEDAAKISAEAMHEKRPTDGKPHLVTNAACFGCTI
ACGRISEIDKGHFTVVNKPEYWGASGGLEYEAAWALGAANGVGDLEALQYANLLCNEHGM
DPISFGATVGAVMELYEMGAISKDELGIEAPFGSAAALARLAEMTARGEGFGKVIGLGSK
RLCEKYGHPELSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPHTTEGKPALVKAFQDATAVFDSAGICIFTSFAWSLADVQPQLQAACEGDWSMDKLHQ
VGERIWNMERQFNLAAGLTAKDDNLPPRLTSEPAKTGPAKGLVNQLDKMLPEYYQLRGWN
ADGVPTADTLQRLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcctggacccgcaagatcctgcgtgtgaatctcagcgcgggcacctgcagcgccgaa
gcgctgaacatgaagtgggccgatgaatatctcggctcgcgtgggcttgccaccaagtac
ctggtggaagagatcgacccgaaggtcgatccgctgtcgcccgacaacaagctgatcatg
gccaccggccccctgaccggcaccatggcctcgaccggcggacgctacaccgtggtcacc
aaggggccgctgaccggcgcgatcgcctgctcgaactcgggcggctttttcggtgccgag
atgaaattcgccggttgggacatgatcatcttcgaaggcaagtctccgaagccggtctat
ttgtatgtcgaaaacgaccgcgccgaactgcgcgatgccgcccatctgtggggcaccagc
tgctggcacaccgaggaaaccatcaagaaggaactacaggacccgctggtgcgggtgtcg
tcgattggccgtgccggcgagaaccaggtgctgttcgcctgcgtggtcaacgacctgcac
cgcgcggccggccgctcgggcgtcggcgcggtgatgggctccaagaacctgaaggcggtg
gcgctgcgcggcacccgtggcgtcggcggcatccgggattttccggccttcatgaaggcg
gtcaatgacggcaagaaggttttggccgacaacgcggtcaccggccaggggctgcccaag
tacggcacccaggtgctgatgaacgtgatcaacgagatcggcgcgttgcccacccgcaac
caccgcgatgtgcagttcgaggacgccgccaagatctctgccgaggcgatgcacgaaaag
cgccccaccgacggcaagccgcacctggtcaccaatgccgcgtgcttcggctgtacgatc
gcctgcgggcgcatttcggaaatcgacaaaggccatttcaccgtggtcaataagcccgaa
tactggggcgcctcgggcgggctggagtacgaagcagcctgggcgctcggtgcggccaac
ggcgttggcgacctcgaggcactgcagtacgccaacctgctgtgcaacgagcacggcatg
gacccgatctcgttcggcgcgacggtcggcgcggtcatggagctgtacgaaatgggcgcg
atcagcaaagatgagctcggcatcgaagcgcccttcggctcggccgccgcgctggcccga
ctggccgagatgaccgcccggggcgaaggctttggcaaggtgatcggcctgggcagcaag
cgcctgtgcgagaaatacggccatccggaactgtcgatgagcgtcaagggccaggaattc
ccggcctacgattcgcgcggcatccagggcatggggctggcctatgccacctccaaccgc
ggcgcctgccatctgcgcggctacacggtggcctccgaggtactgggcattccggtcaag
accgacccgcacacgaccgaaggcaagccggcgctggtcaaagcttttcaggacgctacc
gcggtgttcgactcggccggcatctgtatcttcacctcgtttgcctggagtctggccgat
gtgcagccccagttgcaggccgcttgcgagggcgactggtcgatggacaagctgcatcag
gtcggcgagcggatctggaacatggagcgccagttcaacctggccgccggcctgaccgcc
aaggacgacaacctgccgccgcgcctgacctcagagccggctaagaccgggccggccaag
gggctggtcaaccagctcgacaagatgctgcccgagtattaccagttgcgcggctggaat
gccgacggcgtgcccaccgccgatacgctgcaaaggctgggtttgtag

DBGET integrated database retrieval system