KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_02865Help
Entry
B4966_02865       CDS       T05394                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B4966_02865
Enzymes [BR:rbh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B4966_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C NAD_binding_7 FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase Thi4 Glutaredoxin NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AUL99238
UniProt: A0A2K9LCM9
LinkDB All DBs
Position
603842..605401
Genome map
AA seq 519 aa AA seqDB search
MLDANIKTQLKAYLERVTQPIEIVASLDDSPKSHEMLELLHDVVEQSKLITLIERRDDDE
RKPSFTVGPRGSEARVRFAGLPMGHEFTSLILALLQSAGYPPKVDPEVIEQIKQLEGEFN
FETYVSLSCHNCPDVVQALNLMAILNPNIRHTMIDGALFQSEVEARQIMAVPTVYLNGQE
FGQGRMELAEILAKVDSGAAARDAKKLSEKPAFDVLVIGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVMDTLGIENFISVKYTEGPKLVASLEEHVKEYEVDVMNLQRVAALVPGENLH
QVQLANGAVLQAKAVIIATGARWREMNVPGEKEFRGKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGVVAHVTLLEFADTLRADAVLQKKLYSLPNVTVIKNAQTTEVTGTDKV
NGLVYKDRLSGQMQRIELEGVFVQIGLLPNTDFLKGTLELTRFGEVVVDAKGQTSASGVF
AAGDCTTVPYKQIVIAMGEGAKAALSAFDHLIRSSAPVA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatatcaagactcaactgaaagcctacctggaacgggtgacgcagccg
atcgagatcgtggcgtcgctcgacgacagccccaaatcgcatgaaatgctggaactgctg
catgacgtggtggagcagtccaagttgatcaccctgatcgaacgccgcgacgacgatgag
cgcaagccgtcgtttaccgtcggcccgcgcggtagcgaggcgcgtgtgcgttttgccggt
ttgccgatggggcacgaatttacctcgctgatccttgcgttgttgcagtcggccggttat
ccgcccaaggtcgatccggaagtgatcgaacagatcaagcagctcgaaggcgaattcaac
ttcgaaacctatgtgtcgctgtcttgccacaattgcccggacgtggtgcaggcactgaac
ctgatggctattctcaatccgaatatccgtcacaccatgatcgacggggcgctgttccag
tctgaagtggaggcgcgtcagatcatggcggtgcccacggtgtatttgaacggccaggag
ttcggccaagggcgcatggagctggcggaaattcttgccaaggtcgacagcggtgcggcg
gcccgcgatgccaaaaagctctcggaaaagcctgccttcgatgtgctggtgatcggcggc
ggcccggccggtgcggcggcggcgatctacgcggcgcgcaaaggtattcgtaccggcgtg
gtggccgagcgtttcggcggtcaggtcatggataccctgggcatcgaaaacttcatctcg
gtgaagtacaccgaggggccgaagctggttgccagcctggaggagcacgtcaaggagtat
gaggttgacgtgatgaatctgcaacgtgtcgcggccttggtgccaggggaaaatctgcac
caagtgcagttggcaaacggcgcggtactccaggccaaggcggtgatcattgccactggc
gcgcgctggcgcgagatgaatgtgccgggcgaaaaagaattccgcggcaagggtgtggcg
tattgtccgcactgcgacggccccttgttcaaaggcaagcgcgtggcggtgatcggtggc
ggcaactcgggcgtggaggcggccatcgatctggcgggcgtggtcgcgcatgtcaccttg
ctggaatttgccgacaccctgcgtgccgatgcggtgttgcagaaaaagctctacagtctg
cccaatgtcacggtgatcaaaaacgcgcagaccaccgaagtcaccggcaccgacaaagtc
aacggactggtgtataaagaccggctgtcgggccagatgcagcgcatcgagctggagggc
gtttttgtgcagatcggtctattgcccaacaccgattttctcaagggtacgctggagctg
actcgctttggcgaggtggtcgtcgacgccaaagggcagaccagcgcctccggggtgttt
gccgccggcgattgcaccacggtgccctacaagcaaatcgtcatcgccatgggtgaaggc
gccaaagctgcgctgtcggccttcgatcatctgatccgcagcagcgcgccggtggcctga

DBGET integrated database retrieval system